SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_00421.1|PACid:22052800 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_002_00421.1|PACid:22052800
Domain Number - Region: 71-117
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00468
Family WD40-repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_00421.1|PACid:22052800
Sequence length 174
Sequence
MAKYESITMASFSNNTRNNHGFHFQLVFALVILASCCSLVSSTSILGKVHVFVMNSLGAS
KKLDIQCSSSEDRLGFRALHDGEIYDWKFRVNFSGSTKFVCFMAWINDNNEILSGTFLIY
KHKRDRYKCNGDCLWHVKQSGIYFVDNAGYREEQMFTWPTPPPSKSSNHPKGKE
Download sequence
Identical sequences A0A2G5F336
Aquca_002_00421.1|PACid:22052800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]