SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aquca_002_00439.1|PACid:22052617 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_00439.1|PACid:22052617
Domain Number 1 Region: 85-220
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.68e-37
Family Glutathione S-transferase (GST), C-terminal domain 0.0000457
Further Details:      
 
Domain Number 2 Region: 5-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.03e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_00439.1|PACid:22052617
Sequence length 230
Sequence
MAASDVKILGAWTSPVAMRPRIALNVKNVDYEFQEENLDSKSELLFKSNPVYKKIPIMIH
NDKPICESLIIVQYIDEVFTSGPSLLPSDLYERATARFWATYIDDKWFSALFGTANPKTD
QEKATAIEGLTSGLALLEEAFEKISKGKGFFGGETIGYLDITLGSFLGFLRVAETLSGMN
YIDETKTPNLHGWAKRFCSDPSVKDLMPETKKLLEFAKMHFSGGLGAQRK
Download sequence
Identical sequences A0A2G5F368
Aquca_002_00439.1|PACid:22052617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]