SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_00505.1|PACid:22051945 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_00505.1|PACid:22051945
Domain Number 1 Region: 204-436
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-75
Family SSRP1-like 0.000008
Further Details:      
 
Domain Number 2 Region: 541-624
Classification Level Classification E-value
Superfamily HMG-box 3.67e-26
Family HMG-box 0.0000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_00505.1|PACid:22051945
Sequence length 638
Sequence
MADHRFSNILLVGRGGSNSGDLRVHPGGIKWTSKGGKAVEVDKSDIDGVTWMKVPKTYQL
GVRIKDGLLYKFTGFREQDVSSLTSSIQGNFGKTPEEKQLSISGHNWGEVDLDGNMLTFL
VGSKQAFEVSLADVSQTQVQGKNDVMLTFHMDDTATANEKDSLMEISFYVPNTNTQYVGD
ETRPSAQVFHEKIQSMADVGASGEEAVATFDGIAVLTPRGRYSVELHISFFRLQGQANDF
KIQYSSVVRLFLLPKSNQPHTFVVVTLDPPIRKGQTLYPHIVLQFETDFVVESTLSMSED
LLNNKYKEKLQLSYKGLIHEVFTTILRGLSGAKVTRPGKFRSRQNGYAVKSSLKAEDGVL
FPLEKGFFFLPKPPTLILNDEIDFVEFERHGAGGTSMHYFDLVVKLKNDQEHVFRNIQKN
EYDGLFDFISKKELKILHINQATEGGVASVLRSEDDDAVDPHLERIRNSNADESDEEDED
FVAEKDDGGSPTDDSGEDDSDASDSGGEKEKPVKKEPKKEASTSKPSSAKKRTKDGDEDG
PKKRKPKKKKDPNAPKKALSGFMFFSNSERDNLRKSNPGMAFTDVGRALGERWRSMTAEE
KEPFEAKARVDQKRYKEAMADYKSAPMIVDSGHESDSE
Download sequence
Identical sequences A0A2G5F3F0
Aquca_002_00505.1|PACid:22051945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]