SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_00517.1|PACid:22053797 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_00517.1|PACid:22053797
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-34
Family SSRP1-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_00517.1|PACid:22053797
Sequence length 175
Sequence
MNEDLLNNKYKEKLRASYKGLIHEVFTLILRGLSGAKVTRPGQFRSYENGYGVISSLGDD
DGVLYPLENGFFFLPVPPTLIIMDEVNYVEIQRRGYGGTSMHYFDLLVKLKSEQELVFLD
IRRSEYDNLIMFISEKGLKIHNFGGETADGAPPSHLERIREIADGSDDKVDLTYV
Download sequence
Identical sequences A0A2G5F3F5
Aquca_002_00517.1|PACid:22053797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]