SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_00530.1|PACid:22052416 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_00530.1|PACid:22052416
Domain Number 1 Region: 2-468
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.77e-67
Family Quinoprotein alcohol dehydrogenase-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_00530.1|PACid:22052416
Sequence length 496
Sequence
MQWLNHGGDLHNTRYGVGEVKINPRTVSKLKLKWEFYAGGDISATPSIFCDTVYFPSWNG
NIYAVKQSDGSLVWEKNLTELTGLEPSRFVFGVNFTVSRATPTVAGDLLLIGIYGPAYVI
AVKRSTGKLVWTTRLDSHNASVVTMSGTVYNGYFYVGASSLEETVNIEECCTFRGSMAKL
NIRTGAIIWQTFTLPDNFGKQGEYAGAAIWGSSPSIDIRKNQVYIATGNLYSAPKRVLDC
QEIENNQTVPSHPDQCVEPENHENSVMAFDLDSGNIKWYRQLGGYDLWFVACNDLSTPGC
PPGPNPDADFGEAPMMLTIIVNGSKRDIVALVQKSGYAWALDRDNGNIIWSTVAGPGGTG
GGGTWGAATDERRVYTNIANSLQTNFTLAPSKQTTTAGAWVAMDASTGNILWSTANPRNA
TASGPVTVANSVLFVGSDDPRGSMYALDAKTGTILWSYDTGAAVHGGVSVSDGCIYVGNG
YRGLTPGTSLYAFCIS
Download sequence
Identical sequences A0A2G5F3N4
Aquca_002_00530.1|PACid:22052416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]