SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_00531.1|PACid:22052136 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_00531.1|PACid:22052136
Domain Number 1 Region: 7-433
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.92e-52
Family Quinoprotein alcohol dehydrogenase-like 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_00531.1|PACid:22052136
Sequence length 469
Sequence
MCSTAQRLNHGGDLCNRRYAESEVKISPHTVSKLKLKWEFIAGKDITATPAIFNGTVYFP
SWNGNIYAVKADDGSLVWKKNLDELTGLKSPGFIFLINVTIARATPTVAGDLLIIGIYGP
AVVIAVERTTGDLVWMTRLDSHNSSLITMSGTVHDGGFYVGTSSAEETLTVEQCCTFRSS
LAKLDIQTGAILWQTFTLPDNFGERGEYAGAVIWGSSPSIDTKRNHVYIATGNLYSAPSH
VTECQERENNQTVPTHPDQCIEPENHENSILAFDLDHGNIKWYRQLGGYDIWFFACSDLS
NPLCPPAPNPDPDFGEAPMMLTIIVKGTNFAGPGGFAGGGSWGAATDGHEIYTNIINSDG
LNFTLSPSKKTTNGGGWVAMHAYTGRILWSTANPTNLRASGPVDSEGALFAMDVDTGKIL
WTYNTGATIYGGVSVSNGCVYVGNGYKVSLGANIPTFTAGTSLYAFCIS
Download sequence
Identical sequences A0A2G5F3J5
Aquca_002_00531.1|PACid:22052136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]