SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_00598.1|PACid:22053559 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_002_00598.1|PACid:22053559
Domain Number - Region: 203-233,416-455
Classification Level Classification E-value
Superfamily PH domain-like 0.0577
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_00598.1|PACid:22053559
Sequence length 534
Sequence
MIPSMSEKGMKPSRYLLCLITMSMSLLILSSVFLLQSTTTSLLTGSVFKQIHINNSTLYF
RPNSNSNSNENFNPGSVASTSNGNVQDLITPDSITSKEVRDFREERRTVCDTNEDILKIF
MYDLPSEFHFGLLGWNGEGDQMWPDVSNVSRVPPYPGGLNLQHSIEYWLTLDLLASNTPS
VVRPCSAIRVENASQADVIFVPFFSSLSYNRHSKPQGRERKSINRMLQEKLVEFLTSRDE
WKRQDGKDHIILAHHPNSMLDVRKNLGSAMFVLADFGRYPTKVANIEKDIIAPYKHVVRT
INEDSADFDGRPILIYFQGAIYRKDGGFIRQELYYLLKDEKDVHFTFGSVRGNGINKAGQ
GMASSKFCLNIAGDTPSSNRLFDAIASHCVPVIISDEIELPFEDVLDYSEFCIFIRASDA
IKEGFLLKLLQGIKRDKWTKMWDKLKKVAHHFEYQYPSQPEDAVDMIWGAISHRISSISS
VPFRLHRENRFRLTEGIAKINGLKKEEFLSHNRLPSKREGGRGGRKKKQSKNIL
Download sequence
Identical sequences A0A2G5F3X8
Aquca_002_00598.1|PACid:22053559 Aquca_002_00598.2|PACid:22053560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]