SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_00699.1|PACid:22052467 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_00699.1|PACid:22052467
Domain Number 1 Region: 599-640,710-926
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.48e-58
Family WD40-repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_00699.1|PACid:22052467
Sequence length 1174
Sequence
MESINEDAAQVEQSTKEQETVTWNKPGGTDAHRYTSSEATENYHGRNAFLSNVTSPDTTY
AERSYTPVPLEFHQPRNSKDQQLATVLTHPRNEVQFSVPGLSTIPSLPYYVPGMMNEVMV
PSSQLFQGSQHDVQKHAASTVLPQYNSHPHCSNHVPMMTSFPYYPIQVCMQTGQMPASQL
WPSNGISCSAKVKPDRIGRREAALIKFRQKRKDRCFDKKIRYMNRKRLAERRPRVRGQFV
RQMNGVDVDLNGQPINAGDSDEDNEEEEEELDYDDSRISFASAISTPPEEFRGFAESASS
EDYNIWMAEPGSIKDRRQRLLQGMGLSHDKELLRVSSNEFKLVAPTKPPIPEDPKQESPS
PPHLPSSSPIKLIPRSKSEGSMVSAFAETKCREETLIGADSKPRLLRLSSLPSSQSNRNM
QLRTSTIKPSRAKSRPRSIEAMNGRTLSISSNGGGGGFLIKNLDTGNVFLINEDGTTSSL
SDLQTGKQLTMEEFEKTVGHSPIVKELMRRENVARAPTDVIGESERKIMSASLSTKSFRA
SKKKGSGWLKNIKGVANSINGFIADREKDHTLMQQQPSTTSKWTKVHQHGKSHKEISGLY
MCQEIQAHEGSIWCIKFSPDARYLASAGEDRIIHLWEVIDCDVFSARAIDETISTPLHPL
ANSSADRPPLADAPVFPSERKRRGKLSSASKKRGVPDFVTVPDTVFSLSDKPVCSFEGHL
DDVLDLSWSKSQQLLSSSMDKTVRLWDMESKTCLKLFAHNDYVTCIQFNPMDDEYFISGS
LDAKVRIWSIPDRKVVDWTDLHEMVTAVCYTPDGQGALVGSHRGSCRLYDTTDCKLNQKG
QIDVQTKKKSQAKKITGFQFAPGNPSEVLITSADSRIRIFDGSDITYKFRGFRNTSSQIS
ASFSTDGRYIVSASEDSQVYVWKRDEIQHTSGGKSKGLITTQSYERFQCRDVSVAIPWPG
STKYDPSMLSTQSKRHSKFTPSHSPAPSGTLQEGFLRSPSVTRSQEALVRSLSGTKDQET
FSRRPSVNRVEEVFTRSPSVTRNLPPLPKKNNISDKPAICSEEEPLCVSRTNSGIGDSAA
FVSAPASAASSFRECPSISASESSLSSLSWLFDGANNSVRNNIQPTAWGLVVVAAGLGGE
LRIYQNFGLPVRVGRQANLFASGSVGSTANKRFL
Download sequence
Identical sequences A0A2G5F4C4
Aquca_002_00699.1|PACid:22052467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]