SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_00728.1|PACid:22052922 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_00728.1|PACid:22052922
Domain Number 1 Region: 139-209
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.6e-26
Family Cold shock DNA-binding domain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 68-146
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.45e-25
Family eIF5a N-terminal domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_00728.1|PACid:22052922
Sequence length 212
Sequence
YSHFFRRSSSSWQLHRLSLSFIFSLSLLCSLSLSLVLCVSVFFFSKLSIIFIIIMSDEEH
HFESTDAGASKTYPQQAGTIRKNGYIVIKQRACKVVEVSTSKTGKHGHAKCHFVAIDIFN
GKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGSTKDDLKLPTDDALYTQI
ENGFNEGKDLVVTVMSAMGEEQICALKDIGPK
Download sequence
Identical sequences A0A2G5F4G5
Aquca_002_00728.1|PACid:22052922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]