SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_00728.2|PACid:22052923 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_00728.2|PACid:22052923
Domain Number 1 Region: 85-155
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.83e-26
Family Cold shock DNA-binding domain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 14-92
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 7.02e-26
Family eIF5a N-terminal domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_00728.2|PACid:22052923
Sequence length 158
Sequence
MSDEEHHFESTDAGASKTYPQQAGTIRKNGYIVIKQRACKVVEVSTSKTGKHGHAKCHFV
AIDIFNGKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGSTKDDLKLPTDD
ALYTQIENGFNEGKDLVVTVMSAMGEEQICALKDIGPK
Download sequence
Identical sequences A0A2G5F4L8
Aquca_002_00728.2|PACid:22052923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]