SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_00824.1|PACid:22052322 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_00824.1|PACid:22052322
Domain Number 1 Region: 6-237
Classification Level Classification E-value
Superfamily 14-3-3 protein 3.4e-105
Family 14-3-3 protein 0.0000000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_00824.1|PACid:22052322
Sequence length 259
Sequence
MSTEKERGSLVYNAKLAEQAERYDEMVECMKKVAKLDLELTVEERNLLSVGYKNVIGARR
ASWRIMSSIEQKEDSKGNEQNVKMIKNYRNKVEEELSKICNDILTIIDEHLIPSSTTGES
TVFYYKMKGDYFRYLAEFKIDEEKKDAADQSLKGYQAASNTASSDLSPTHPIRLGLALNF
SVFYYEILNSPERACHLAKQAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDLPE
GAEDGGIKAEEPKAAEPEH
Download sequence
Identical sequences A0A2G5F4Y5
Aquca_002_00824.1|PACid:22052322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]