SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_00862.1|PACid:22051693 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_00862.1|PACid:22051693
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 7.32e-22
Family Ribosomal protein L39e 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_00862.1|PACid:22051693
Sequence length 51
Sequence
MPSHKTFIIKKKLAKKMRQNRPIPHWIRMRTDNTIRYNAKRRHWRRTKLGF
Download sequence
Identical sequences A0A061GJN5 A0A251JCV2 A0A2G5F560
XP_002285383.1.54126 XP_007011758.1.67643 XP_015577456.1.68434 XP_015583470.1.68434 XP_015884724.1.98330 XP_015893232.1.98330 XP_021277206.1.83089 CGD0031871 Tc09_g001700 Aquca_002_00862.1|PACid:22051693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]