SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_00948.1|PACid:22051850 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_00948.1|PACid:22051850
Domain Number 1 Region: 2397-2471
Classification Level Classification E-value
Superfamily RING/U-box 7.65e-18
Family ZZ domain 0.0036
Further Details:      
 
Domain Number 2 Region: 3717-3928,4107-4149,4226-4279
Classification Level Classification E-value
Superfamily ARM repeat 0.00000187
Family Armadillo repeat 0.081
Further Details:      
 
Domain Number 3 Region: 1611-1821
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000212
Family Cell cycle arrest protein BUB3 0.065
Further Details:      
 
Domain Number 4 Region: 2642-2689,2725-2806,2865-2906,2962-3094,3433-3472,3720-3911
Classification Level Classification E-value
Superfamily ARM repeat 0.0000672
Family GUN4-associated domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_00948.1|PACid:22051850
Sequence length 4882
Sequence
MNCSREKKSMDRVLMTLASEFLQPDSQAIISSELASRRDLNNMVSLSQHLAVVHMRCIPR
LVMWCKELFDTPDSLSETECGNHRMKLSFSLRILKVLRSVTKDIPYIAYDLELLQAVASC
ADSLPSLFRLNFDFVNYHSTSSENSFEGLVLILLEEFLQFVQVVFCDANILQNIQTCIVA
SIFDTLEAGIWRYNKSALEMKPPLAYSPRSVIYLLKLIGDVKKRKSLPHSWHEKLNKDRI
DSTQEVNAPSCIVRSEKVTLLKDYSWEELLMIVFPSSTQWVDNLMHLAFFLHSEGVKLKP
KIERSHSLSVKSSVSADLDGAVSHEDDALFGDLFSEVGRPVSSTDGPEQSSIAVSCISSY
CHMPIQAATELLSFLKSCIFSSEWSSSVYDDACRKLHTNHIDFLLSILKCQTCLSDEKSS
ERKSGHINEVCFELLHNLLIRRAFVDPLEEHLVDHILRVEDGIFVYNDHTLSLLAHTLIS
RVGLSGSQLRTKLFQGYADFVIEKTRSVSLQCPSIKELLGTLPHIFHIEILFMAFHLSSE
VEKKTLANLVFSSIKEANAPTDQLSTLQLSCWALLVSRLVVVLRYMIFYPSTCPSWLLLD
MRARLRESPFSRSCNPNVSDHGLSWPSNVVENLMGEWVKEEPVISNLLHQLIDVSTVPAS
VCRDQKALDCLSLSLDDIYASLSRILGFWRGKHAESAEDLIIERYMFVLCWDVPITSSSL
LLLSSGSDSHVSDTLNMECFLRVSHFLVSNSGVTVKDINFSDVFVSLLNELCTPRMADNV
EKLGWDFLRDGACLSFLLSLLHSGLWASSVKNGISKTEPLWSGHASNDNEFHSLAESMVG
ILSQREHVAWLFKTLSSLLQRYLQVHQEAFVYTLDQRGCHEGRFSPLLLVKHTEFDRCKQ
DELLEKSGSTPCQLNAIYGLMSKLDNVVHGKVSGNMNQMFLGCLLHGFPLHPRTPSAALL
SSVLIVRGIICTLDLLVNIKDAGGKGYVETEVVRQLLDSLMDVRSDQIFQSIHGKCEAII
HSLSMQQEGMDLRYLFVLKQMESFIRDINLRGTTDSETHEWLLTRAVDTMEGLIKDPSKA
NVFTLYLGTNKDVSDEAKDFYGGQCGNLLVLIEALDDCHSDPVNVKVFNFFVDILSGELC
VGLKRVVQEKFLALDSIYLSKWLERRLLGSSTEGDTSAKASSALLRESTMNFILRIISPA
SELQSRDINSHFTEALLMSLDHAFILYDIQTAKAYLHLIVQLSNGETSLKKLLERTVMLM
EKLAGNENTLQGLKLLFSFLGYVLNDSGASKSIMDKSSSKHLSSSSLGLGSVVSRHVGSR
KNAETLLLSANQETSSATIDCDATSMDEDEDDGTSDGELASMDKDEEEDNNSEKALASKV
CTFTSSGSNFMEQHWYFCYTCDLTVSKGCCSVCAKVCHRGHRVVYSRLSRFFCDCGAGGV
RGSSCQCLKPRKFTGSNNVPVRSAGNFQSYLPFPEDGGQLPDSDSDLDDDAYADMETSFK
LSMSREMQDGIIAVLEDLDVEGRVLELCNRLLPSVISRRDSNLSKDNKVILGEDKVLSYG
VELLQLKKAYKSGSLDLKIKSDYSNARELKSLLSNGSLVKSLLSVSIRGRLAAGEGEKVS
IFDVGQLIGQATIGPVTADKSNVKPLSKNIVRFEIVHLIFNPLVESYLAVAGYEECQILT
VNHRGEVTDRLAIELALQGAYIRRVDWVPGSQVQVMVVTNKFVKIYDLSQDSISPLHYFT
LPDNLIVDATLVVAPQRKVYLIVLSDLGHLFRLEVSADGDVGAKPLTEVIQVPGKHVQSK
GLSLYFSPAYRLLFLSYQDGMSLVGRLNASATTLTEISAIYENEPDCKLRPAGLHHWKEL
LSGSGFFVCSSSNKSNGVLAVSMNSLELFAQNMRHTAGSALPLVGITAYRPLSKDKTHYL
ALHDDGSLQIFTHVPVGVDAGASSSSNQTKKLGPAILSNKAYAGSNAEFPLDFFEKTVCI
TADVKLSGDAIRNSDSEGTKQSLASDDGFLESPSIAGFKINVSNSNPDIVMVGFRLHVGN
TSANHIPSEITIFQRVIKLDEGMRSWYDIPFTIAESLLADEEFTICVGPTFNGSTLPRID
SLEVYGRAKDEFGWKEKMEALLDMEAQVLGSNSGVARSGRKCRSLQSGPIQEQVIAYGLK
LLSKFYSLCRSVGCSEVEEVKQELNKLRCKQLLHTLLESDREPLLQSAASHVLQAVFPKR
EIYYHVIIWIVYLCQVKDTMRLFGIVKSSPVLASRLGVGGATGGWVIEEFTAQMRAVSSI
ALHRRSNLATFLETNGSEVVDGLMQVLWGILDIEQPDTQTINNIVIPSVELIYSYAECLA
LHGNDGGQHSVAPAVALLKKLLFAPYEAVQTSSSLAISSRLLQVPFPKQTMMTTDDIAEN
VVMIEEDAATSSVQYCCDGCSTVPILRRRWHCTVCPDFDLCEACYEVLDADRLPPPHSRD
HLMSAIPIEVESLGGDGNEIHFSMDDLADPNLLSVGAEVSVQNSPPSIHLLEPNEAGEFP
ASMDDQRIVSISASKRAVNSLLLCELVEQLKGWMETTSGKFVRWFLQEINLQKSFVSKTR
SFFGEVVILVFMFFTLMLRNWNQPGSDNSLLKTSGTADTQDKTVQISSSASAVTPSSVDD
QDKNEFASHLLRASCSLRQQAFINYLMDILQQLVHVFKSSTVNFDAGNPSSGCGALLTVR
RELPAGNYSPFFSDSYAKSHRADIFMDYQRLLLENTFRLVYSLVRPEKQDKSGEKDKVYK
TSSSKDLKLDGYQDVLCSYINNPHTTFVRRYARRLFLHLCGSKTHYYNVRDSWQLSNEVK
KLYKLVNKSGGFQNHVPYERSVKLVKCLSAISEVAAARPRNWQKYCSKHGDVLSFLMNGI
FSFGEESVTQTLKLLNLAFYTGREMGHPVQKVESGDAGTNSNKSGSQSLDSKKKKKNEDG
AESGVEKSYQDMEQAVQIFDDKDGNVLRQFIDCFLLEWNSTTIRVEAKCVLYGIWHHAKQ
PFREAMLATLLQKVRHLPLFGQNIVEYTELVTWLLGKVNESSSTQQDAELVSRCLNPDVM
KCIFDTLHSQNELLANHPNSRIYNTLSGLVEFDGYYLESEPCVACSCPEVPYSRMKLESL
KSETKFTDNRIIVKCTGSYTIQTVTMNVHDARKSKSVKVLNLYYNNRPVADLSELKNNWS
LWKRAKSCHLASNQTELKVEFPIPITACNFMIELDSFYENLQASSLESLQCPRCSRSVTD
KHGICGNCHENAYQCRQCRNINYENLDSFLCNECGYSKYGRFEFNFMAKPSFSFDNMEND
EDMKKGLAAIESESENAHRRYQQLLGFKKPLLKLVSSIGENEIDSQQKDSVQQMMVSLPG
PSCKINRKIALLGVLYGEKCKAAFDSVSKSVQTLQGLRRVLMNYLHQKHSDNTVASSRFA
VPRSPNNCYGCATTFVTQCLELLQVLLKHPHCKKQLVAAGILSELFENNIHQGPKNARVL
ARAVLCAFSEGDLNAVTELNSLMQKKVMYCLEHHRSMDIALATREELLLLSETCSVADEF
WEARLRVAFHLLFASIKLGVKHPAISEHVILPCLRIVSQACTPPKPDTEDKDQVIGKASL
VLVKDDRNTNPPTIGRSSGSKPISEVLEKHRDGSQKAQDIQLLSYSEWEKGASYLDFVRR
RYKVSQTVKGSGQRSRPQKFDYLALKYALRWKRRTCKSTKSDLSAFELGSWVSELALSAC
SQSIRSEMCMLISLLCSQSSSRRFRMLNLLMALLPATLSAGESAAEYFELLFKMTESEDA
RLFLTARGCLRTLCRLITQEVGNVESQERSLHIDISQGFILHKLIELLSKFLEVPNIRSR
FMRDDLLSEVLEALLVIRGLIVQKTKLISDCNKLLKDLLDSLLLESSENKRQFIRACISG
LQIHGEERKRRTSLFILEQLCNMICPLKPESVYLLILNKVHTQEEFIRGSMTKNPYSSAE
IGPLMRDVKNKICHQLDLLGLLDDDYGMELLVAGNIISLDLSISQVYEQVWKKSNNQSPN
NTAANSTMLSSGSFASARDSPPMTVTYRLQGLDGEATEPMIKELEEDREETQDPEIEFAI
AGAVREYGGLEIILSMIQHLRDEELRSNQEELVSVLNLLMYCCKIKENRRALLRLGALGL
LLDTARRAFSVDAMEPAEGILLIVESLTLEANESDIGITESVLTVTNEESGAGEQAKKIV
LMFLERLCHPSGFKKSNKQQRNTEMVARILPYLTYGEQAAMEALIQHFYPYLQDWGKFDQ
LQKQHLDNPKDETIAQQAATQRFSVENFVRVSESLKTSSCGNRLKDIILEKGITSVSVRH
LSESFAFAGQAGFKSSAEWTLGLRLPSVPLILSMLRGLSRVHLDTQMCIYEGGILPLLHA
LEGVPGENEIGAKAENLLDTLSDKEGKGDGFLEKKVRELRHATRDEMRRRALRSREEMLQ
GLGMRQELASDGGERIVVAQPTIEGLEDVEEEEDGLACMVCREGYSLRPNDMLGIYSYSK
RVNLGTGTSGSSRGECVYTTVSHFNIIHFQCHQEAKRADAALKNPKKEWEGATLRNNETL
CNCIFPLKGPFVPMAQYVRCVDQYWDNLNALGRADGSRLRLLTYDVVLMLARFATGASFS
TDCKGGGRESNSRFLPFMIQMARHLMDQGSSTQRHSMARAVSSYLTSSSAEPKSSNSPGV
RSSSGTEETVQFMMVNSLLSESYESWLTHRQAFLQRGIYHAYMQHTHGRSMLRLSSDPTP
AGKSESGSTSEIPGAEAEGNNLFSIIQPMLVYTGLIEQLQRFFKLSKSSNASAVKTERST
ESDGSDSTAGLEAWEVIMKDKLINVKEMLGFSKELQSWLEDMTSAADLQEAFDVMGALSD
VLSGGFSKCEDFVQAAIQAGKS
Download sequence
Identical sequences A0A2G5F5H1
Aquca_002_00948.1|PACid:22051850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]