SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_01026.1|PACid:22053756 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_01026.1|PACid:22053756
Domain Number 1 Region: 338-533,603-646
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 8.83e-40
Family Pyruvate phosphate dikinase, N-terminal domain 0.024
Further Details:      
 
Weak hits

Sequence:  Aquca_002_01026.1|PACid:22053756
Domain Number - Region: 51-103
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000712
Family Single 4Fe-4S cluster ferredoxin 0.038
Further Details:      
 
Domain Number - Region: 194-271
Classification Level Classification E-value
Superfamily Phosphohistidine domain 0.0366
Family Pyruvate phosphate dikinase, central domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_01026.1|PACid:22053756
Sequence length 647
Sequence
MLNQAYHVLMRENLRKDYDASIGKMRGEFAREFTGSGYSSWNGPMRPQALFVDETACVGC
RECVHHANNTFMMDETVGCARVKVQYGDDGQKIEGWDLAQKMCKRGDDQWALYAKSVLDR
TRLALASKAEHYDKVLQPSAEYLGSLLDVDQWAVNIFTEEIIRAGSAASLSSLLNRLDPV
LRKTANLGSWQVISPIEAVGYVVVVDELLTVQNMTYEKPTILVAKSVKGEEEIPDGAVAV
LTPDMPDVLSHVSVRARNSKVCFATCFDPNILNDLKEKEGKLLQLKPTSADIVYSELKDG
ELLGGSSTTLRDDDSPSLTLVKKQFCGRYAISSEEFTNEMVGAKSRNISYLKGKVPSWVG
IPTSVALPFGVFEKVLSDDSNQKVAATLLSLKRKLGEGDFNALGEIRQTVLQLAAPPQLV
KELKSTMQGSGMPWPGDEGEKRWEQAWTAIKKVWASKWNERAYFSTRKVKLDHDYLRMAV
LVQEIINADYAFVIHTTNPSSGDSSEIYAEVVKGLGETLVGAYPGRALSFISKKNDLNSP
KVLGYPSKPIGLFIRRSIIFRSDSNGEDLEGYAGAGLYDSVPMDEEEKVVLDYSTDPLMT
DSKFRHSILSSIAGAGKAIEDLYGSPQDIEGVVRDGKIFVVQTRPQM
Download sequence
Identical sequences A0A2G5F634
Aquca_002_01026.1|PACid:22053756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]