SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_01038.1|PACid:22052713 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_002_01038.1|PACid:22052713
Domain Number - Region: 78-155
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0178
Family Myosin rod fragments 0.0073
Further Details:      
 
Domain Number - Region: 180-265
Classification Level Classification E-value
Superfamily Sec2 N-terminal region 0.0628
Family Sec2 N-terminal region 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_01038.1|PACid:22052713
Sequence length 344
Sequence
MAGLLAWAADVVGGNHSNDEDENNQFPTVIFTPEQQIYVRELDQKANSLRRSIQDLRLRI
PPPDISQRLPHLHAHSLASNAALALQLNAHSSTKEEVQQRKIALQEENSAYEKAISDCEK
KIQEKSQEKDLLETKLKEMDMVEKDLKSELENIQATAELNNFGESLGDPAITKGAEADAN
STSDILEQLDAKRKELSSMEEFVEQLEKKWALVQQNSLRQPSPAQREKILDKQLHGLIEQ
LAAKQAQAESLVGEIHAKEKELEKLNGFRRGLENGNMDMNSTRYRFGRSSSGRFSSPDYT
EDGHLKSSFAGGRTETQKRLMLLRSSFVLYILVLHILVFIKISF
Download sequence
Identical sequences A0A2G5F5Y2
Aquca_002_01038.1|PACid:22052713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]