SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_01094.1|PACid:22052152 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_01094.1|PACid:22052152
Domain Number 1 Region: 297-611
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 3.92e-65
Family DNA repair protein MutS, domain III 0.00012
Further Details:      
 
Domain Number 2 Region: 616-861
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.38e-51
Family ABC transporter ATPase domain-like 0.0000068
Further Details:      
 
Weak hits

Sequence:  Aquca_002_01094.1|PACid:22052152
Domain Number - Region: 148-309
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 0.000654
Family DNA repair protein MutS, domain II 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_01094.1|PACid:22052152
Sequence length 941
Sequence
MEENLQDHNRLPELKLDAKQAQGFISFFKTLPNDTRAIRFFDRRDYYTAHGENASFIANT
YYHTTTALRQLGSGSDGISSVSVSRNMFETIVRDLLLERTDHTLELYEGSGSKWRLSKSG
TPGNLGSFEDVLFANNEMQDSPVIVALCPLFRENECTIGMGFLDLTKRVLGLAEFLDDSQ
FTNVEATLVALGCKECLLSAESGKSVESKNLRDALSKCDVLLTERKKSEFKSRDLAQDLS
RLVKGSIEPVRDLISNLDLASGALAALLSYAELLADERNYGNYTVQRYSLDSFMRLDSAA
MRALNVLESKTDANKNFSLFGLMNRTCTSGMGKRLLNRWLKQPLLDVVEINRRLDMVQAF
VEDTELRQDLRQHLKRISDIERLTHNLEKRRAGLQHIVKLYQSSIRLPYIKSALGRYDGQ
FSSLIKESYLDPLEYWTDDDHLNKFIGLVEASVDLDQLQNGEYMISSGYDSNLSTLKDER
DAVEQQIQNLHKQTANDLDLQMDKALKLDKGTQYGHVFRITKKEEPKIRKKLSTLFMVLE
TRKDGVKFTNSKLKKLGDQYQKLLEEYTDCQKQLVARVVQTAATFSEVFDSLAGLLSELD
VLLSFADLAVSCPTPYTRPSITHSEEGNIILEGSRHPCVEAQDGVNFIPNDCTLVRGESW
FQIITGPNMGGKSTFIRQVGVNILMAQVGSFVPCDRASISVRDCIFARVGAGDCQSRGVS
TFMQEMLETASILKGATDKSLIIIDELGRGTSTYDGFGLAWAICEHLVEVTRAPTLFATH
FHELTALAHGNASESSDKVILGVANYHVSAHIDSSTRKLTMLYKVEQGPCDQSFGIHVAE
FANFPESVVALAKEKAAELEDFSAISITSNEAKEEVGSKRKREYGPDEISRGAARAHKFL
QDFSSLPIEEIGLQQALEQASKLKNDLEKDAADCSWLQQFF
Download sequence
Identical sequences A0A2G5F652
Aquca_002_01094.1|PACid:22052152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]