SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_01113.1|PACid:22051974 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_002_01113.1|PACid:22051974
Domain Number - Region: 19-59,187-234,339-419
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0842
Family WD40-repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_01113.1|PACid:22051974
Sequence length 482
Sequence
MVLMQACKLNLPHSLRSSLEVNSLLFEHSSNTLALMHSDSSILLFPSLSPFSSPSTQSQT
LIPPFSSSSCFLRLQSTPNSSSSNTRVIFLVAGPRHGDSRVLLRFWILHKTNNINMFVKA
KVSCNQKGFVCDDRVGVLVDLSHGISVKLAGSVNVFAMHSISARKIWVFAAKMIGDEVDS
VSVKLMKCAVIDCTIPICSITVSSGFFILGECNGVRIFPLRHIIKGKMKKQRDYARKKEK
KTVLQNCGACLENGECGSSDKNCKSVVKLQSVDNGLGGKNIAFKESAESLSNGYTGKPEV
NNPAAKHKTLKMKQESSAGGTFFVGFTNQAAQNQKSNMNQLFSVKAVSIHSLSQKKFLIL
DSVGELHLLDLYSMSPGSEIFGQMRRLSHIIKVQMLAVHPDIYTRTQTFWVSDGVHSVHA
MSVSDVEVSLNENEKSENEEKQLQISAIEAVFASERIQDLIPLSTNAILMLGQGNIYAYA
IS
Download sequence
Identical sequences A0A2G5F6B8
Aquca_002_01113.1|PACid:22051974 Aquca_002_01113.2|PACid:22051973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]