SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_01226.1|PACid:22052221 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_01226.1|PACid:22052221
Domain Number 1 Region: 30-145,186-258,296-365,395-470,618-720
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.8e-39
Family Quinoprotein alcohol dehydrogenase-like 0.036
Further Details:      
 
Weak hits

Sequence:  Aquca_002_01226.1|PACid:22052221
Domain Number - Region: 750-829
Classification Level Classification E-value
Superfamily Putative isomerase YbhE 0.0824
Family Putative isomerase YbhE 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_01226.1|PACid:22052221
Sequence length 834
Sequence
MEEVKRVFIGAGCNRIVNNVSWGASGLVAFGAQNAVAIFCPKTAQILTTLPGHNATVNCT
QWIPSTKEAFKVQHLENHYLLSGDANGAIIVWEFSLKDRKWRNVLQVPKTHKKGVTCISG
TVVSQTASIFASTSSDSTVNVWELLLPSTIGGDCKLSCLDSFSLGSKPMVALSLAELPGS
TAHLVLAMGGLDNKIHLYCGERAGKFTHSCELKGHTDWIRCLDFSLPTSTSGEKDSLLLL
SSSQDRCIRLWKIALCSSPANSEIPYRKKEIGLASYIEGPVIITGSSSYQISPESLLIGH
EDWVYSVQWQPPSSTPAEGNDVCQPQSILSASMDKTMMIWQPEKTTGIWMNVVTVGELSH
CALGFYGGHWSPCGDSILAHGYGGSFHLWRNVGVNFEDWQPQKVPSGHFAAVTDIAWSRS
GDFMLSVSHDQTTRIYAPWKEEVCSEDGYTWHEIARPQVHGHDFNCVAIIQGKGNHRFVS
GADEKVARVFEAPLSFLKTLSYAHFQKSFAPEDLQDNVQILGANMSALGLSQKPIYVQAT
NEAPQKSSNDDLDTLGAIPDAVPVVLTKPPIEEQLALNTLWPESHKLYGHGNELFSLCCD
HEGKIVASSCKAQSATVAEIWLWQVGSWKAVGRLQSHNLTVTNMQFSHDNAFLLAVSRDR
QFSLFSINTTGVDNVSYELVARQEAHKRIIWTCSWNPFGHEFATGSRDKTVKIWGVQNKS
SVKQLITLPQFTSSVTALSWCGCSSLRNKGILAVGMESGLIEVWTLSRNKIDVSGMEVPS
FDAAVAVRFDPFMCHVSTVHRLAWKDIENEDCRTLQLASCGADHCVRVFQVGVN
Download sequence
Identical sequences A0A2G5F6V4
Aquca_002_01226.1|PACid:22052221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]