SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_01277.1|PACid:22052187 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_01277.1|PACid:22052187
Domain Number 1 Region: 13-311
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.75e-46
Family Quinoprotein alcohol dehydrogenase-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_01277.1|PACid:22052187
Sequence length 475
Sequence
MMKEALVVCSDKSLSAGITVWDIETGDHLLHIPTCASPPHGLVCLRNHFLVASQIQKQGS
VAGGAIFIWPLNKPHAPLRNYPIEATGPLCCTKDGLYLAGGTLSGKAYVWEVSSGRMLKC
WHAHKKSLTCLNFSSDNSFLISGSNEGEIRVWSTISLLDMTDFQSVPSFFHAWMEHQSSI
TGLLTSDISSSVLISSSLDGTCKIWDLISNKVVRTHAFPLAITAITLDPEERFLFSGSSD
GRIFVNTLDAGLEEENEVLSEEQSLMVLSGHKGAITALSFSLSGLFLISASEDCTACLWD
VKSWAVIHNFSHKKAGHITNIVVIPQSLLLPRTENLHKVSFQFRVSPLDKYPQPESTAKR
SVTLLPKYCSLEHDHIMSGFQITHTMNQQIMDLEQDRTPEAIQMKVDTIVERRLWATSMA
KHVTEMNKHLRSRLLDLMQSRLSCPLEFSAIGKRRQFGASSVSPAGDECREYPTY
Download sequence
Identical sequences A0A2G5F747
Aquca_002_01277.1|PACid:22052187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]