SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_01310.1|PACid:22051770 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_01310.1|PACid:22051770
Domain Number 1 Region: 11-111
Classification Level Classification E-value
Superfamily 14-3-3 protein 2.35e-22
Family 14-3-3 protein 0.0000848
Further Details:      
 
Domain Number 2 Region: 216-318
Classification Level Classification E-value
Superfamily 14-3-3 protein 6.41e-16
Family 14-3-3 protein 0.00055
Further Details:      
 
Weak hits

Sequence:  Aquca_002_01310.1|PACid:22051770
Domain Number - Region: 136-174
Classification Level Classification E-value
Superfamily 14-3-3 protein 0.0837
Family 14-3-3 protein 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_01310.1|PACid:22051770
Sequence length 361
Sequence
MDLEEMTEGLSREDNVYLAKLAKLAMRYEDMVGFMDKVVQTVKLEELNKEEKYLWFMGYK
NVIRARATSWEIISSIERKEKCMGNAGHVKRINKYMRKIRPNIREICSKIMLNLKSVDFF
LINSVLPDQFKENFVENQVEHVDNMNSKIETDVLKICDELLDIFQLHLTVEPLEGMSYEF
MEHIFPNCFSRGGNIDYDIYLSELESGLEQVKISEMSREEGVYMAVLAQQAVRFNDMFDF
MKGVVTEIKVDELTLEERRLWSLAYIEKVSTVGYTLGIVSSILDMEEDKQDKDRAIIIKK
YMHKLLKEFYEIYALTLKHTNKAEPLEFSTQLSLKSYFQMHRVCLSYLHIIKPGLQTEEA
S
Download sequence
Identical sequences A0A2G5F7B4
Aquca_002_01310.1|PACid:22051770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]