SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_01425.4|PACid:22053110 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_01425.4|PACid:22053110
Domain Number 1 Region: 112-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.22e-49
Family B3 DNA binding domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_01425.4|PACid:22053110
Sequence length 746
Sequence
MKLSASSGLGQQGQEGEKRCLNSELWHACAGPLVSLPTVGTRVVYFPQGHSEQVAASTNK
EVDGHIPNYPNLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKDTYIPAELGIP
SKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDVEWKF
RHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRASRPQTVMPSSV
LSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLSKYVKAVFHTRVSVGMRFR
MLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPL
TTFPMYPSLFPLRLKRPWHPGLSSLHDDAASGLMWMRGDTAERGLQSLNFQGLGVNPWLQ
QRVDPSMLRNEHDQQYQAIAAAALQDIRNGDPLKQQFLQFQQPFQYLQQSSGPNPLLQQQ
LMQQTLPQQMLNEQAQNLAENQPRHLLQQQLQQQLQQSLSGQQKQQAQQQQQQTYQEAFQ
MSNNQFQQQQQSIPAPLCQKTDFTDSNVTFSASLNPSSIQNMLGSLCPGGSGNLLNFPRM
SESMLSDSQQQQQWVQKFPYSQGNAFEGSASLPSYLGKDGAVEADNGDAQSHTLFGVNID
SSPLLLSSVIPSLGTSAIDADVSTTPFGASGFQNSLYGCMDDSSDLLHGAGQGDPPTRTF
VKVINYFPLFSKVELYLYIYIYSMDR
Download sequence
Identical sequences A0A2G5F7Z2
Aquca_002_01425.4|PACid:22053110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]