SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_01439.3|PACid:22053790 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_01439.3|PACid:22053790
Domain Number 1 Region: 7-242,291-316
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.32e-62
Family BAR domain 0.0029
Further Details:      
 
Domain Number 2 Region: 469-595
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 8.37e-37
Family Pyk2-associated protein beta ARF-GAP domain 0.00029
Further Details:      
 
Domain Number 3 Region: 294-334,369-440
Classification Level Classification E-value
Superfamily PH domain-like 4.44e-24
Family Pleckstrin-homology domain (PH domain) 0.0063
Further Details:      
 
Domain Number 4 Region: 604-637,684-768
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.64e-19
Family Ankyrin repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_01439.3|PACid:22053790
Sequence length 780
Sequence
MSHFIKLEDSPMFRKQLHFVETTTDELKDRCQRLLKGCKKYVAALEYACDADIAFADSLE
DFGAGRDDPVSVAIGGPVISKFITTFRELGTYKELLRSQVEHMLSERLMQFISVDLHGVK
ESRRRFDKATHAYDQAREKFMSLKKGARADIVAELEEDLQNSKSAFERCRFNLVNALTNI
EAKKKYEFLESVSAIMDAHLRNYKQGFELLSQIEPFIHQILTYAQQSREMANIEQDKLAK
RIQEFRTQAELDSLRASSNVVASTSNHGVHISRANSYKNIEALMLSAVKGEVQTIKQGYL
LKWSSSLRGDWKRRFFVLDSQGTLYYYRDKGTKLGGFQSHQSTGTSERVFGRFRPRHHRA
SSLGEENLGCHTVNLRMSTIKIDAEHSDLRLCFRIISPSKTYTLQAENEAERMDWVDKIR
GVIASLLTSPFLDKDVNVNSSSGGVGCESSSPDAHVSSEDELKFQRQDSVSRTLRAIPGN
GICAECSASEPDWASLNLGILLCIECSGVHRNLGVHISKVRSITLDVKVWEPPILDLFHN
LGNAYCNSVWEELLHLHNQSDEADATLSITKPEPKDDYVKKETYIHSKYVEKLLVLKEAT
ECGIPSHATRIWEAIKSDNLQAVYRLIVTSNVNINTSYDEVDATDCYHSIDTPDSEDGSR
HSAERKQFDPTTCPRIKDSGEPGNCLKGCSLLHLACHVGDIVMLELLLQFGADINFSDFH
GRTPVHHCISKRNNVFAKYLLRRGARASIKDGGGLTVLERAMEMGAITDEELFILLTKSE
Download sequence
Identical sequences A0A2G5F897
Aquca_002_01439.3|PACid:22053790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]