SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aquca_002_01454.1|PACid:22053979 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_01454.1|PACid:22053979
Domain Number 1 Region: 3-99
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 3.01e-35
Family Ribosomal proteins L24p and L21e 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_01454.1|PACid:22053979
Sequence length 164
Sequence
MPAGHGLRSRTRDSFSRAFRKKGYIPLSTYLRTFKIGEYVDIKVNGAIHKGMPHKFYHGR
TGKVWNVTKRALGVEINKQVGNRIIRKRIHVRIEHVQASRCKEEFKQRKIQNDKLKAEAK
ARGEKISTKRQPQGPKPGFMVEGATLETVTPIPYDVVNDLKGGY
Download sequence
Identical sequences A0A2G5F861
Aquca_002_01454.1|PACid:22053979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]