SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00004.1|PACid:22049687 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00004.1|PACid:22049687
Domain Number 1 Region: 44-334
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.99e-49
Family WD40-repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00004.1|PACid:22049687
Sequence length 353
Sequence
MEQQSEREREHNHNHNHHHQQQHHYHHHHQDKVSLELTEEILKSMEVGMAFRDHNGRISS
MDFHKASSYLVTASDDESIRLYDVTNAMCLKTINSKKYGVDLVCFTSHPTTVIYSSKNGW
DESLRLLSLHDNKYLRYFKGHHDRVVSLSMCSRKECFISGSMDRTVLLWDQRAEKCQSLL
RVQGRPAVAYDDQGLVFAIAYNGFIRMFDARKYEKGPFDIFSVGGDISDANVVKFSNDGR
LMLLTTMDGRIHVLDSFRGTLLSTYNVKPVSSNSTLEASFSPEGTFVVSGSGDGSVYAWN
VRTGKEVISWISTEFEPPVIKWAPGCLMFATGSSELSFWIPDLSKLASFIGSK
Download sequence
Identical sequences A0A2G5EX17
Aquca_003_00004.1|PACid:22049687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]