SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00023.1|PACid:22049414 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00023.1|PACid:22049414
Domain Number 1 Region: 55-300
Classification Level Classification E-value
Superfamily Pseudouridine synthase 3.36e-77
Family Pseudouridine synthase II TruB 0.00000164
Further Details:      
 
Domain Number 2 Region: 302-383
Classification Level Classification E-value
Superfamily PUA domain-like 6.08e-23
Family PUA domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00023.1|PACid:22049414
Sequence length 589
Sequence
MSELEISRSEKKKKKNRTKEDDELPITNSTTSSVDLIQKDDFLIKPQTFTPTLDTSQWPI
LLKNYDRLNVRTGHYTPLPSGFSPLKRPLAEYIRYGILNLDKPANPSSHEVVAWIKRILR
VEKTGHSGTLDPKVTGNLIVCIDRATRLVKSQQGAGKEYVCIARLHSAVPDVAKVARALE
TLTGAVFQRPPLISAVKRQLRIRTIYESKLLEYDADKHLIVFWISCEAGTYVRTLCVHLG
LLLGVGGHMQELRRVRSGIMGEKDNMVTMHDVMDAQWMYDNYRDETYLRRVIMPLEVLLT
SYKRLVVKDSAVNAICYGAKLMIPGLLRFENEIENGEEVVLMTTKGEAIALGIAEMTTAV
MATCDHGVVAKIKRVVMDRDTYPRKWGLGPRASMKKKMISEGLLSKHGKPNEKTPAEWTR
NVVLPTGGDAMVAGHAAATEQVSLKVEDNVVEEKEKKKKKKHKDEEDGEGQKRKLDDSSL
SPAPVSTKKVKVEEDVVMEVASAEKKEKKKKKKDKENGEAALSDQEKSEKKKKSKEKAEA
GSSDDDKSEKKKKKKKSKESEENTNAEEEVDKSEKKKKKDKKKKDKDAE
Download sequence
Identical sequences A0A2G5EWX5
Aquca_003_00023.1|PACid:22049414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]