SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00208.1|PACid:22050389 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_003_00208.1|PACid:22050389
Domain Number - Region: 4-37
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0403
Family WD40-repeat 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00208.1|PACid:22050389
Sequence length 68
Sequence
MLTKFETKSNRVRGLSFHPKRPWILASLHSGVIHCGIIEWDLLLTSTMVQFVVYIFTNLN
LCLSLDVF
Download sequence
Identical sequences A0A2G5EXW7
Aquca_003_00208.1|PACid:22050389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]