SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00228.2|PACid:22050481 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00228.2|PACid:22050481
Domain Number 1 Region: 4-168,196-315
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.94e-74
Family WD40-repeat 0.0000469
Further Details:      
 
Domain Number 2 Region: 197-402,459-565
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 5.1e-22
Family DPP6 N-terminal domain-like 0.037
Further Details:      
 
Weak hits

Sequence:  Aquca_003_00228.2|PACid:22050481
Domain Number - Region: 1086-1129
Classification Level Classification E-value
Superfamily TPR-like 0.00759
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00228.2|PACid:22050481
Sequence length 1217
Sequence
MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
NWQSRTCVSVLTGHNHYVMCANFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDLLR
LSQMNTDLFGGIDAVVKYVLEGHDRGVNWASFHPSLPLIVSGADDRQLKLWRMNDTKAWE
VDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVWDVTKRTCVQTFRREHDRFWILASHP
EMNLLAAGHDSGMIVFKLERERPAFSVSGDCLYYVKDRFLRFYEFSTQKDSQVIPIRRPG
TTNLNQSPRTLSYSPTENAVLVCSDIDGGSYELYTIPKDSVSRGDSIQDAKRGVGGSAVF
VARNRFAVLDKSNNQVLVKNLKNEIVKKSILPIVAEAIFYAGTGNLLCRAEDRVVIFDLQ
QRLVLGDLQTPFIKYVVWSNDMESIALLSKHSIVIASKKLVHRCTLHETIRVKSGAWDDN
GVFIYTTLNHIKYCLPNGDSGIIKTLDVPIYITKISGNTIFCLDRDGKNRAVIIDATEYV
FKLSLLKKKYDQVMSIIRNSQLCGQAMIAYLQQKGFPEVALHFVKDERTRFNLALESGNI
QIAVASANAIDEKDHWYRLGVEALRQGNAGIVEYAYQRTKNFDRLSFLYLVTGNTNKLSK
MLKIAELKNDVMAQFHNALYLGDVHERIKILENVGHLPLAYMTATVHGLNDVAEQLAAKL
GDNVPSLPHGKVPSLLMPPTPILCGGDWPLLRVMKGIFEGGLENIGRGVQEEDEEAADAD
WGEELDIVDGEGAQNGDVGAVEDGEANDENDEEGGWDLEDLELPPEVDTPKVSANARSAV
FVTPTPGMPVSQIWIQKSSLAGEHAAAGNFDTAMRLLSRQLGIQNFTPLKPMFLDLHAGS
HSYLRAFSSSPIIILAVERGWSETSSPNVRGPPALVFNYSHLEEKLKVGYRATTGGKFTE
ALRILKDILHTIPLIVVESRREVDEVRELIFNAKEYVVGLQMEIKRKELKDDLVRQQELA
AYFTHCNLQTPHLRLALLNAMRICYKEKNFNTAANFARRFLETNPSNETQAKTARQVLQS
AEKNLIDENQLNYDFRNPFVVCGATYVPIYQGQKDVACPYCGSRFVPSQQGQLCTVCDLA
VVGSDASGLLCSPSQIR
Download sequence
Identical sequences A0A2G5EXZ9
Aquca_003_00228.1|PACid:22050482 Aquca_003_00228.2|PACid:22050481 Aquca_003_00228.3|PACid:22050483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]