SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00253.1|PACid:22049859 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00253.1|PACid:22049859
Domain Number 1 Region: 89-426
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 6.8e-71
Family Catechol oxidase 0.00000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00253.1|PACid:22049859
Sequence length 593
Sequence
MSLSFLATTTPTTTSFDRRSSKATHSVARTLIRKRFTPTTCEQKHEGNGVGVNAERSGID
RRDVLVGLGGLCGATATFGSNMAVGAPVQPPDLSACRLANDLQLVNRVDCCPPYGTTTIT
DFVLPDQSEPMRVRRSAEALASDPVYLEKFRRAVALMKALPADDPWNFMQQAQIHCAYCN
DAYTQVGFPAVSLQLHGSWLFLPWHRYYIYFWEKILGKLIDDPTFAIPYWNYDQPSGMRF
PDIYKNSPKDQNPLFDCIRNPEHLNGALMDYRYEFGDPSPTPEQEESVILENQKYLYNMF
AENLFNPGNFMGQPISEGQTLNAPGTLENLHAIPHRFASQVERPRWHMGNFHTAARDPVF
YAHHAQIDRLWTIYKERRAITTPEFPTDEWLEASFIFYDENRNVVKCKVRDCLDPTQLRY
MYQTDEKAWLNIRRSYYTKKKAAPRSAGADELVAISEFGSEPRLLDTTIRVLVTRPKASR
TQEEKDEAAENIFIDDFTFDHTDYAGFDVFVTKATEGLATADLGEFAGSFVHIPHAHGPS
DHRNILHLGITYLLEDIADAEASEQLVVSIVPRSGEVTLTGVSIQLVPKEGTS
Download sequence
Identical sequences A0A2G5EY05
Aquca_003_00253.1|PACid:22049859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]