SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00323.1|PACid:22050369 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00323.1|PACid:22050369
Domain Number 1 Region: 65-323
Classification Level Classification E-value
Superfamily Pseudouridine synthase 6.19e-72
Family Pseudouridine synthase I TruA 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00323.1|PACid:22050369
Sequence length 349
Sequence
MAGSSCSSSSVVLLGLPSPPAPTTPSSLPSHHTSSNSWKTKLSSGGGTEDPTATLCKNPT
TLAETYKWRMVIAYDGTHFSGWQYQQSTPKTIQCLVEKALAKTTKLEREELILVGASRTD
TGVHAWGQVAHFITPFNYDRLDSIHAALNGVLPSDIRVRELSPALPEFHARFSSTGKIYH
YKIYNDIIMDPFQRRWAYHSTYRLNAAAMREGARYFVGQHDFTSFVNASNSDHPRSPVKH
IIRFDVIELQGALIQLEVEGSGFLYRQVRNMVALLLQIGKEAVPPDIVPMVLAARDRKEL
AKYTVGAPPHGLCLMSVKYNEELLEPPSGCRATSFGRHHTISKCKLPFY
Download sequence
Identical sequences A0A2G5EYD4
Aquca_003_00323.1|PACid:22050369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]