SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00323.10|PACid:22050378 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00323.10|PACid:22050378
Domain Number 1 Region: 7-171
Classification Level Classification E-value
Superfamily Pseudouridine synthase 7.34e-37
Family Pseudouridine synthase I TruA 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00323.10|PACid:22050378
Sequence length 197
Sequence
MSYNRCLFQVAHFITPFNYDRLDSIHAALNGVLPSDIRVRELSPALPEFHARFSSTAMRE
GARYFVGQHDFTSFVNASNSDHPRSPVKHIIRFDVIELGALIQLEVEGSGFLYRQVRNMV
ALLLQIGKEAVPPDIVPMVLAARDRKELAKYTVGAPPHGLCLMSVKYNEELLEPPSGCRA
TSFGRHHTISKCKLPFY
Download sequence
Identical sequences A0A2G5EYK9
Aquca_003_00323.10|PACid:22050378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]