SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00323.2|PACid:22050370 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00323.2|PACid:22050370
Domain Number 1 Region: 65-322
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.4e-72
Family Pseudouridine synthase I TruA 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00323.2|PACid:22050370
Sequence length 348
Sequence
MAGSSCSSSSVVLLGLPSPPAPTTPSSLPSHHTSSNSWKTKLSSGGGTEDPTATLCKNPT
TLAETYKWRMVIAYDGTHFSGWQYQQSTPKTIQCLVEKALAKTTKLEREELILVGASRTD
TGVHAWGQVAHFITPFNYDRLDSIHAALNGVLPSDIRVRELSPALPEFHARFSSTGKIYH
YKIYNDIIMDPFQRRWAYHSTYRLNAAAMREGARYFVGQHDFTSFVNASNSDHPRSPVKH
IIRFDVIELGALIQLEVEGSGFLYRQVRNMVALLLQIGKEAVPPDIVPMVLAARDRKELA
KYTVGAPPHGLCLMSVKYNEELLEPPSGCRATSFGRHHTISKCKLPFY
Download sequence
Identical sequences A0A2G5EYE1
Aquca_003_00323.2|PACid:22050370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]