SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00323.5|PACid:22050373 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00323.5|PACid:22050373
Domain Number 1 Region: 6-213
Classification Level Classification E-value
Superfamily Pseudouridine synthase 3.31e-51
Family Pseudouridine synthase I TruA 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00323.5|PACid:22050373
Sequence length 239
Sequence
MAPIFQYQQSTPKTIQCLVEKALAKTTKLEREELILVGASRTDTGVHAWGQVAHFITPFN
YDRLDSIHAALNGVLPSDIRVRELSPALPEFHARFSSTAMREGARYFVGQHDFTSFVNAS
NSDHPRSPVKHIIRFDVIELGALIQLEVEGSGFLYRQVRNMVALLLQIGKEAVPPDIVPM
VLAARDRKELAKYTVGAPPHGLCLMSVKYNEELLEPPSGCRATSFGRHHTISKCKLPFY
Download sequence
Identical sequences A0A2G5EYB5
Aquca_003_00323.5|PACid:22050373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]