SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00355.1|PACid:22050289 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00355.1|PACid:22050289
Domain Number 1 Region: 484-785
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-78
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 73-182
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.01e-23
Family alpha-D-mannose-specific plant lectins 0.0054
Further Details:      
 
Weak hits

Sequence:  Aquca_003_00355.1|PACid:22050289
Domain Number - Region: 358-403
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00706
Family Hairpin loop containing domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00355.1|PACid:22050289
Sequence length 813
Sequence
MKSLGRIVSICNKELVHTNCAADTISSGQSLTLNQTLISNSGTFELGYFTPGNSRNYYIG
IWYKKVSVQNKTVVWVANRDTPLTDSNSSEFKLLENGNLVLLNLSKLAIWSTESKSNVNL
SYEGVLGDDGNFVLRTGVRPSDVFWQSFDYPTDTFLPGAKIGYNRITNKQLSLTSWKNSN
DPARGLYSLELDRSVDQYFIQSNLNRYWNSGEWNGRSFSLIPEMTLNSNFNFSFVENENE
SYFTSSADTTSSTLSRLVMDSSGQFNQFSWVGDAQAWFSLWSQPRQQCEVYRYCGEFGIC
QDNASVCTCLNGFQPRSPIDWNLNDFSGGCMRKTSLQCGDDDRFLQVHLVIETSNQRLNY
DIETADNCEQSCLNDCSCNAYAFNTSCLLWNESLFNLQQFQDSDDGISIQLRLAASEIPS
PEGKKTLKAYIIVLIVGSILIGILGCGLFAYKMKQRGKIKYKSRETSPPVFSIDQESEQG
KLELPSFDLSTIAAATNNFSNKLGQGGFGSVYKGNLQDEREIAVKRLSRSSGQGVEEFKN
ELMLISKLQHRNLVRLLGYCIDREEKILLYEYMPNKSLDAFLFDPNRKVLLDWSKRFNII
DGIARGLLYLHRDSRLKVIHRDLKASNILLDEDMIPKISDFGMARIFGGKQTLANTNRVV
GTYGYMSPEYAMEGTFSEKSDVFSFGVMLLEIVSSKKNSNFYFLEESYNLLGYVWRKWNE
NKVLEIMDPTLSDSYNIQELKRCIHIGLLCVQDHVLDRPTMSTIVFMLGSEGTLPLPKQP
AFTLEREQLSDILVNIADAVSINYVTITKPEGR
Download sequence
Identical sequences A0A2G5EYE0
Aquca_003_00355.1|PACid:22050289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]