SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00357.2|PACid:22049506 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00357.2|PACid:22049506
Domain Number 1 Region: 467-751
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.47e-80
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 81-190
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.09e-24
Family alpha-D-mannose-specific plant lectins 0.0046
Further Details:      
 
Weak hits

Sequence:  Aquca_003_00357.2|PACid:22049506
Domain Number - Region: 367-406
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0212
Family Hairpin loop containing domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00357.2|PACid:22049506
Sequence length 796
Sequence
MKRRSQTCLVLIFFFFFYSSTSLTHLCFAADTISSGQSLTFNQTLISKGGKFELGFFTPP
GTSLNYYYIGIWYKNIPNKTVVWVANRDIPLTDPTSSEFKLLENGNLVLLNQSKLAIWST
QSTSNANVSFQGVLGDDGNFVLRTGVRPSDIFWQSFDYPTDTLLPGAKLGYDSITNKVQS
LTSWRSSNDPARGLYILELDRDTNNDDHFHILTNWFRYWRSGRWNGTVFSGDPEMNDILN
FSYLKNENERYLIYSLYNTYSLSRLVMDISGQLKQFSWLEETQEWLLKWSRPTQCDVYRY
CGAFGVCDENNLPLCRCLNGFKPQSLKDWNMSNFSGGCVRKRYLECGDEVGFLQDNQQIG
LSGQNFNYTFKTAGDCEQSCLDDCSCNAYAFNSSCLHWSQDVFPFKTAYDEVMFSIQLRV
AASEIPSSTSEIRKPTSGGKLGYETSSETSLAILPVEHEREQGKLELPLFDFNTVATATD
NFSNKLGQGGFGPVYKGKLLDEREIAVKRLSRSSGQGLQEFKNELILISKLQHRNLVRLL
GYCIDRDEKILLYEYMPNKSLDAFLFDPTKRILLDWSRRFSIIDGIARGLLYLHRDSRLR
VIHRDLKASNILLDEDMNPKISDFGMARIFGGKQTLGNTNRVVGTYGYMSPEYAMEGIFS
EKSDVFSFGVLLLEIVSSKKNTKFYLLEESYNLLGYVWRKWNENEVLEIMDPTLAESYNS
QEWMRCIHIGLLCVQEHAHDRPTMSAVVSMLGSEGTLPFPKQPAFTIEREQLSDVLVNIT
DAVSINHVTITKSGGR
Download sequence
Identical sequences A0A2G5EYH5
Aquca_003_00357.2|PACid:22049506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]