SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00359.1|PACid:22050499 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00359.1|PACid:22050499
Domain Number 1 Region: 448-734
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-77
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 57-148
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-17
Family alpha-D-mannose-specific plant lectins 0.0042
Further Details:      
 
Weak hits

Sequence:  Aquca_003_00359.1|PACid:22050499
Domain Number - Region: 323-359
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0981
Family Hairpin loop containing domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00359.1|PACid:22050499
Sequence length 779
Sequence
MKPRSQTWLLLLVIFFFCSSTSLTHLCFAADDTISSGQSLTLNQTLISKGGKFELGFFTP
ENGNLVLLTESKTAIWSTESTSNANVSSEAVLGDDGNLVLRTVVRPSDVFWQSFDYLTDT
FLPGAKIGYNSITNKVQSLTSWRSSNDPARGIYSLELDRDDDDHFHIVTNRIRYWRSGPW
TGTAFSGDPEMNDILNFRYIKNDNESYLMFSHKNTYNISRLVMDFSGQFKQFSWLEETQE
WLLIWSQPTQQCEVYRYCGPFGVCDENNLPLCRCLNGFKPQSLKDWNMRNFSGGCVRKTN
LKCGDEVGFLQYNQQIGFSNQRFNNSFNTADDCKQSCSDDCSCNAYAFNNSCLLWKQDVF
AFKNGYDEATFSIQLRVAASEIPRPTSGGKKPLKAYIIVLIAGSIFVGIFSCFLIAYIMK
RQRKPGYETTETSLADLSSEHEPEQGKLELALFDFNTVATATNNFSNKLGQGGFGPVFKG
KLLDEREIAVKRLSRSSGQGVQEFQNELMLISKLQHRNLVRLLGYCIGKEEKILLYEYMP
NKSLDAFLFDPIKQILLDWSKRFSIIDGIARGLLYLHRDSRLKVIHRDLKASNILLDEDM
NPKISDFGMARIFGGKQTLGNTNRVVGTYGYMSPEYAMEGIFSEKSDVFSFGVLLLEIVS
SKKNTNFYLLEQSYNLLGYVWQKWNENKVVEIMAPTLAESYNSQELMRCIHIGLLCVQEY
AHDRPTMSAIVFMLGSEATLPLPKQPAFILERTQLSDILYNNNDAVSMNFVSITNPDGR
Download sequence
Identical sequences A0A2G5EYG4
Aquca_003_00359.1|PACid:22050499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]