SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00361.1|PACid:22049246 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00361.1|PACid:22049246
Domain Number 1 Region: 472-762
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.58e-74
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 80-174,206-237
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.23e-27
Family alpha-D-mannose-specific plant lectins 0.0038
Further Details:      
 
Weak hits

Sequence:  Aquca_003_00361.1|PACid:22049246
Domain Number - Region: 385-421
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00726
Family Hairpin loop containing domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00361.1|PACid:22049246
Sequence length 799
Sequence
MLHEFNEPVAQYLTLGCMHHEFNEPVAKNLTLSRMSLLEDMLEEFLVIEGQSLTFNQTLI
SKGGKFELGFFTPGTSLNYYYIGIWYKNIPNKTVVWVANRDIPLTDPSSSEFKLLENGNL
VLLNQSKFVIWSTESASNGNVSSQVMLGDDGNFVLRTGVRPSHTIWQSFDCPTDTILPGA
KIGYNRITKMRQSLTSWRRSIDPAKGLYSVEPDPDRDEYFIKSNQNQNRSWSSGTWNGIL
FSLIPEMRLRYVKNENESYFTCDVFNSSIPFRLMMSWSGQLQHFEWAESIQSWNLFWSSQ
PRQYQCEAYLIYGYCGSFSVCDQNNLPLCRCLNWGFKPQSPKDWNLSDFSGGCVRINNLQ
CKDEVGFLQDYQQNGFFNQLLNDAIKTADDCKQFCLDDYSCNAYAFNSSCLLWKRDEFVR
PPLQKDPLQKDEGQPAVYIQLRVAASMIQSSTSVVPRPTSGEHEPEQGKLDLPLFDFNAV
AIATNNFSNKLGEGGFGPVYKLLDEREIAVKRLSRSSGQGLQEFKNELMLISKLQHRNLV
RLLGYCIGREEKILFYEYMPNKSLDAFLFDPTKHILLDWSKRFRIIDGVARGLLYLHRDS
RLKVIHRDLKTSNILLDEDMNLKISDFGLARIFGGKQILANTSRVVGTYRYMSPEYAMEG
IFSEKSDVFSFVVLLLEIVSSKKNNNFYLLEESYNLLGYVWLKWKENKVLEIMDPTLAES
YNIQQLMRCIHIGLLCVQDHALDRPTMSAVVSMLGSEGTLPLPKQPAFTIERSQFSKIHF
NINDAVSINSVTLTNPVGR
Download sequence
Identical sequences A0A2G5EYR8
Aquca_003_00361.1|PACid:22049246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]