SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00362.2|PACid:22049486 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00362.2|PACid:22049486
Domain Number 1 Region: 505-684
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-54
Family Protein kinases, catalytic subunit 0.00025
Further Details:      
 
Domain Number 2 Region: 75-172,204-233
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.29e-26
Family alpha-D-mannose-specific plant lectins 0.0041
Further Details:      
 
Weak hits

Sequence:  Aquca_003_00362.2|PACid:22049486
Domain Number - Region: 253-303
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0183
Family C-type lectin domain 0.018
Further Details:      
 
Domain Number - Region: 372-404
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.051
Family Hairpin loop containing domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00362.2|PACid:22049486
Sequence length 684
Sequence
MPIVHVREYSMTSRSQTWLLLLVIFFFIYSFKSGTHLCFAVDTISSGQSLTLDQTLISKG
GKFELGFFRPGTSLNYYIGIWYKNVSIQTVVWVANRDTPLYGGFSPELKLLENGSLVLLD
DSKTAIWSTESTSNGNVSAEAVLGDNGNLFLRKRVIRSTSEVFWQSFDYPTDTFLPGSKI
GYNKLTNKQISLTCWRSPDDPAKGLYSLHLDPYGDQFFIESQGIRYWSSGAWNGKTFSLI
PEMGLKYIFYFSYVKNENESYFTYDLYNTSIITKLVLDLSGQIKQFTWADNSRTWFLFWS
QPRQQCEVSGFCVCDSKCRCFDGFLPRSPNDWNTSDYSGGCMRKTYFECGDEVGFLQDNQ
QTAFFNQQFNDTVKTADKCKQSCLDDCSCTAYAFNSSCLLWKGDVFASRKFGDDEARYSI
QLKVAASEILTQTSGISRETSGGNKPLNKPYIIVLIAGSIFVIIFSCFLFAYKMKQRGNK
LRYETTETSLPDLSVENEPEQGKLELPLFDFNTVATATNNFTNKLGQGGFGPVYKGKLLD
EREIAVKRLSRSSGQGVQEFKNELMLISKLQHRNLVRLLGYCIGREEKILLYEYMPNKSL
DAFLFDPTKQILLDWSKRFSIIDGIARGLLYLHRDSRLKVIHRDLKASNILLDENMNPKI
SDFGMARIFGGEQTLANTNRVVGT
Download sequence
Identical sequences A0A2G5EYF5
Aquca_003_00362.2|PACid:22049486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]