SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00395.1|PACid:22049872 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00395.1|PACid:22049872
Domain Number 1 Region: 67-236
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000018
Family DnaQ-like 3'-5' exonuclease 0.018
Further Details:      
 
Weak hits

Sequence:  Aquca_003_00395.1|PACid:22049872
Domain Number - Region: 21-66
Classification Level Classification E-value
Superfamily PH domain-like 0.00047
Family Pleckstrin-homology domain (PH domain) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00395.1|PACid:22049872
Sequence length 250
Sequence
MEVTVERIETEMKNIEDRYWSKNDRYELFNVHVGDKRILTLFTESNSVMKKWVSELQKAN
RKNKSNYPLIVGMCVDRELEYLKKGLKDNPYDVIVFCTGSNCLIYSLPDGEHYGGGYGSN
EVPKVLKEFLADSKAIFVGMDIADVSKKLEKDQELKVERSVDIRCLGEKVLDLWMRHMKE
FNLDQIAEMMLDERMDFERSDIFDKWRDRDSRGFEINRDYAKYLTVDAFLLHEMATKYVD
ITTKLVSNSK
Download sequence
Identical sequences A0A2G5EYM8
Aquca_003_00395.1|PACid:22049872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]