SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00429.1|PACid:22049309 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00429.1|PACid:22049309
Domain Number 1 Region: 472-756
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.07e-75
Family Tandem AAA-ATPase domain 0.000053
Further Details:      
 
Domain Number 2 Region: 14-53
Classification Level Classification E-value
Superfamily WW domain 0.0000000906
Family WW domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00429.1|PACid:22049309
Sequence length 1058
Sequence
MATTEVAAASLGPRYAPEDPTLPKPWKGLIDGSSGVLYYWNPESNITQYERPANLEPLSA
PGVVLGPKLAPIPMARSQQNNVMPTQQGQDMSQNYQIPQVQHMFQQQPGQFKPQHQSSQF
GEDTQRQGTQMTQGVHQQGVQQNWQSLPQQSRDEQSQQPGQRMPQHLEQQTWQQHAVQKP
LHMQHQQFPSQQPFQGALSMQGKQMLQPQPHQGAYQQGQPIGFSPRGESEFQRGKENGFS
SSKIPQPGVSLYQHHPQSGTPVVHAQHGADPGQQQNMGRPMFPGQQPGGPPMEVKMGYGD
DLRGRAGGEFYFNANKGSSVMGSQQSNLATAPLPQKQMVMEDIHRVTPGHTNGSAMTHNA
AFVPPPLMHGSLDIANLSAVDVYRREHEVTATGDNVPGPFMTFEATGFPPEILREIHFAG
FSRPTPIQAQTWPISLQSRDIVAIAKTGSGKTLGYLVPAFIHLRQCRPSTLNGPRVLILA
PTRELATQIQDEAVKFGRSSRISCTCLYGGAPKGAQIRELDRGVDIVVATPGRLNDILEM
KKIDFRQVSFLVLDEADRMLDMGFEPQIRKIVDEIPPHRQTLMYTATWPKEVRKIAADLL
VNPVQVTIGRVGELAANKAITQYVEVVSQMNKQRRLEQILRSQEQGSKVIIFCSTKRLCD
QLTRSIGRIFGAAAIHGDKSQGERDHVLNQFRSGKSPILVATDVAARGLDIKDIRMVINY
DFPTGIEDYVHRIGRTGRAGATGVAYTFFSDQDRKHAADLVKVLEGANQKVPPELQEMAM
SGRPSFGKSHGELPRGDSGGGRMFAGGRGGMRDGGFDSRGGMRDGGFDSRGGMRDGGFDS
RGGMRDGTFAGRGGQRDEDFGGRRGRADFGGRGNRGRGFSGPARGPGAWGRHDSGPPERH
NNDSRGQYNNRRGITDGGRGRSSGRNYNASPDMVSTWDTRSSSSDRSRSRSRSRSRSRGR
SRSRSRSRSRSIIRNHTRSRNRSRSRSPGSFKRSREQDYSRSERVDPPKSKISTLAPSSP
GDPNSGKLVLSESAVPGGSTDEAKPSLLPAVDVEGSIV
Download sequence
Identical sequences A0A2G5EYV7
Aquca_003_00429.1|PACid:22049309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]