SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00461.1|PACid:22050210 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_003_00461.1|PACid:22050210
Domain Number - Region: 578-640
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0196
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00461.1|PACid:22050210
Sequence length 664
Sequence
MKPTFIAGTSVEVNLRDEQCHGAWFPATILKDIDHELFLVGYQSLRFKEGCSKEVINATH
IRPSPPENFDWKVFAVSEKVDVYYDCGWWSGQVKEVLPGNQYIVLFNHQKKAREFNHFEL
RCHMEWINGRWVQDPWPTKESKFITGMAVEVSIHDKRYHGAWFPATILKKYDHNSFLIGY
HSLRLSNEVECSKEILDAQHMRPSPPESFEGKEFVESEKVDAYYDCGWWNGKVTKVLGTN
RYIVQFEHQNIEREFNHFELRCHMEWISGKWVQDSWDIEETPNQCDVDKIDLPQLSQVCN
TSVGIDIANESYKSKRKIQEFPSEPCQKLKKGEAAETSTLIPDLQRKMPARTMSESGPSF
DLSTPTTTEEKALPRNKKDISRNLNDIFSSPSEGLSDPPRLCFGQEKSTNVIDCENSGNP
QTLRDSSLSPLSAIEGVYCDLSRTQVQLLQKTLQVQPHCTNSLHGDNQNLPFIKRNPVWQ
DLEAMGIFRSIPQLPHFRPLEQLSEFLREGQAVGYMLSYAIIADKASKAQVDEPRISLES
KLNALLDLELLGFYVQPIRARLEELLRVKDCRVQLAVELKQVEEKIMKGENEKESLESEL
EKFDKKINDFQEFIIQLNKQRQMIFMEKQNKGLSIDELQQKICETEEEIHGIKLQFAHAA
AAPW
Download sequence
Identical sequences A0A2G5EZ03
Aquca_003_00461.1|PACid:22050210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]