SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00497.1|PACid:22049837 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00497.1|PACid:22049837
Domain Number 1 Region: 214-321
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.15e-22
Family Canonical RBD 0.0041
Further Details:      
 
Domain Number 2 Region: 112-186
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.4e-20
Family Canonical RBD 0.0037
Further Details:      
 
Domain Number 3 Region: 578-608
Classification Level Classification E-value
Superfamily WW domain 0.000000000318
Family WW domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00497.1|PACid:22049837
Sequence length 1007
Sequence
GFQLPSNHRNWIIKVNNNINDHLFKTIEECLIEIENLLTTTTITTTVTTTIETLIEVKQL
IINNAIKATVIHKIILLMDFEKKIMILVTLCLFLVENALFLSQVQQSCVRDENHTDNGGH
LKLFIANVPRRAIEDDIRPLFEEHGNVVEIYLIKDKISGQRRGCCFVKYSSLEDAERAIK
ALHSQYTFPGILFFIITWYMNYIGSWSFLSCFSVGTDERKVYVAGLNKQATENEIAEIFS
TYGRVEDVCILRDNMKQSLGRGFVEFVQRDMVLAAINALNGTYVMTGCDQPLIVRFAHPR
KPKAGESRNDAAFRGSGIGPRVHTSLDIRPESNDGSPISVAHTQPNGWIKTSSQSSGPSS
QAHDFASHSIAKNGAAPVRIATSSKHPVIEVPSGGQLLPLEKPLHPSLQFPPSLLSHTQI
TPCTSQMQASHPPTQQLDQLQIPSSVGPCSQALPSEHLNGNRKHSTQCHSHQSTFAAAAQ
LISLNVQTKDEPSTASQKQLCGPAILQKPLQKSSNQLAEVLTPQLSQTATQEPRSDDAIQ
QSSFTGNMQQAAATTTVVTSSAVSIPPHTWTSPPTCEWSEHTCPDGFKYYYNCLTKESRW
EKPKELIFSKEQQQKLPVQLADIQSRVQKLLISIDSACQMHLTATSSTSRGRYNGSGQSA
DFSNRDRGFYWGSSSGANRVSYGNSGCGRRDQRGDWNREKQNGDTQSYGWSKGDGDDQLS
GWGIQGSGNNRTSDSGWNKGKPHGDDQSSGWSKDANVDAGDQVGGWGNQGSGNNRTSDSG
WNKGKPRGDDQSSGWSKDANTDARDQVGGWDSQGAGNNRTSDSGWNKGKPHGDDQSSGWS
KDANADAGDQVGGWGSQLSGNNRTSDSGGNKGKPHGEDQSSGWSKDANTDSGDQVGGWGS
QVSGNKDTCNSDWKGEKPHVDNKSFGWRTQISGNLGTSNCEGCAGKQIDNWNQSNVTGKT
VLAGWNKTIGAKGETNKSGAQADDVWGKAIMNSWGKENSGSGGKGGW
Download sequence
Identical sequences A0A2G5EZ57
Aquca_003_00497.1|PACid:22049837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]