SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00561.1|PACid:22050208 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00561.1|PACid:22050208
Domain Number 1 Region: 233-502,532-660
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.32e-67
Family WD40-repeat 0.00028
Further Details:      
 
Domain Number 2 Region: 1664-1762
Classification Level Classification E-value
Superfamily Bromodomain 0.0000000196
Family Bromodomain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00561.1|PACid:22050208
Sequence length 1765
Sequence
MALRKHQPPGYASPLGMVPLKFSNKVHEKAPFVEPETARGPPLEDDVDIDLSEVYFLIMH
FLSAGPCHRTYGQFWNELLEHQLLPRRYHAWYSRSGAHTGDENDNGFSFPLSYNKLVERY
PHIGTNHLVKLLKQLILTNAPPLHGMIGGNAPNAADVPTLLGSGSFSLLGSDRNRETKKN
NRPPDYLRWPHMKADQVRGLSLREIGGGFSKHHRAPSIRAACYAIAKPSTMVQRMENIKK
LRGHRDAVYCAIFDRSGRYVITGSDDRLVKIWSMETAFCLASCRGHDGDITDLAVSSNNA
WVASASNDCIIRVWRLPDGLPIAVLRGHTGAVTAIAFSPRPSSATHLLSSSDDGTCRIWD
IRHTNMSPRVYVPKPLDAGKSTGPSSSTGPSPGTAPPSHQILCCAYNANGTVFVTGSSDT
FARVWNACKSNGDDPTQPNYEMDLLSGHENDVNYVQFSGCSVASRFYAESSNEDNIPKFK
NSWFTRDNIVTCSRDGTAIIWVPKSRRSHSKFGRWSKAYHLKVPPPPMPPQPVRGGPRQR
LLPTPRGVNMIVWSLDNRFVLAAIMDCRICVWNAADGSLVHSLTGHSESTYVLDVHPFNP
RVAMSAGYDGKTIVWDIWEGTPLRIYDIGRFKLVDGKFSPDGTSIILSDDVGQIYILNTG
QGESQKDAKYDQFFLGDYRTLIQDTHGNVLDQETQLAPYWRNIHDMLCDSSMMPYPEPYQ
SMYQQRRLGALGIERRYSSVNFSVGPVDVNSIQDYQMVPLPDLDRIIEPLPEFLDAMDWE
PENEVQSEDNDSEYNVTDDPSEGEKGSLGTISSGDSECSAEDSEDDEHSLKDGLRRSNRK
KSKEEVEFMTSSGRRVKRKNLDECDGTSSRINRTRKARKGKKSLKRKSSRSKSLRPQRVA
ARNARNFLSRINGVCTDEDVDNSEDESSDGESILAESDFQSNESDRSVENLQQKISKGKE
VSLDEVVKASELQCQTNARNKMKLVLKLPSRDSKLALPTDYTRTEVEKKVHLDSLFEAQE
NIEVSKNHFNLQGPGSSSGSLFDPVLSQNKGEGLSRVREQPVKVEDYLDLSTSYQDNNIK
WGEVKVRTSKRVRHGDINIGSNMDEQKEIRNSINGHCKPESEYGIEFIHSETLVNGDEPD
RTAYNKKQQYWDCTSNGASDYTTSPDNVHKLPLDKHQKKLDGSLLICNSNLIMESKDQSE
PRECRDYEEPLEVVDPGLKKGTGPSKEVEEASTSMPTKLRIRMKTIWEDPRNSTEPKSFH
AVEDRTSSGCDSASQGPLPMVGNLAQELTKENERSSRFGESSSQIDNISRISVLQESKKP
HEESTNRMYNAVYKRSKPFRSRAVSENDGVDMEESTSNGSNNNADSKIDFPDTTTDGVRR
TRSMAMKATTRESYNEFQVRGHRSVEASRSGEKFACEQLLSDNWGIAKVRGGLRSARNRR
ENYSDNNLTPLSKRNLHQSLKKLSWLMLSEHEENYRYIPQLGDEVAYLRQGHEGYIEWRH
HRSKEKGPWTKFEGLRAVEFCKVEELEYSTFTGSGESCCKVTLGFLDRSSSVFGKTFKLT
LPELNDYSDFLVERTRYDASMNRNWTKRDKCQVWWRNDNEEGGSWYDGRIVAVQPRSPDF
PDSPWERYAIQYKSDADQHLHSPWELHEPDTPWFHPSIEEEMRKRLLSSLAKLEQQGIRN
KDRYGLQKLEQASQKSDFLNRFPVPLTFEVIQSRLDHNYYRSLEAVKHDFIVMLVNAQSY
FVKNEELKVKLRRLSDWFNEKLLPL
Download sequence
Identical sequences A0A2G5EZH2
Aquca_003_00561.1|PACid:22050208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]