SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00565.2|PACid:22050448 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00565.2|PACid:22050448
Domain Number 1 Region: 14-111
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000148
Family Ran-binding domain 0.072
Further Details:      
 
Domain Number 2 Region: 196-250,277-487,514-648
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000335
Family MIF4G domain-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00565.2|PACid:22050448
Sequence length 665
Sequence
MGAQGKPSNSVNPMQRVKVYRLNDDGKWDDRGTGHVTVDYLERSEDLGLFVTDEEDNETL
LAHRIRSDEIYRRQEDTIISWRDPEYSTELALSFQEATGCSYIWDNICNVQRNMHFNSLS
DLEIGPRPAVETLEASGTSQAHDEPYHSVNSELRELPAVELSTLPLILKTVMESDVADQM
RVTELIVHSPNFFTKLMDLFRICEDLEDLDGLHTIFKIVRGIFLLNSPHIFEKIFGDEII
MDIIGSLEYDPEVRHVQHHRGFLKEHVVFKEAIPIKDPSVLSKIHETYRVNYIKDVILPR
VLDDATISSLNSIVHANNAIVVSSLKDDNTFIQELFARMRSSTISAESKKNLVLFLHEFC
NLSKSLQLAQQMRLFRDLVSEGIFDILTEVFRSQDKRLILTGTDILILFLNQDPNLLRMY
VTRQEGNALLGLLVKGMITDFGENMHCQFLEILRSLLDSYTLSGSQRDTIIEIFYEKHLN
QLIEVIVLSCPPKGVDHKVAQSLCFGEKDKNQGVIKPEILSNILELLCFCVHHHPYRIKC
NFLFNNVIEKVLFLTRRREKYLVVAAIRFVRTIISRHDEQLLLHIVKSNLLKPIVDAFVA
NGNRYNLLNSAVLELFEYIRKENLKTLIRYLVDTFWSQLVEFNNLPSLLALKVKYDQVSL
SLSLP
Download sequence
Identical sequences A0A2G5EZI0
Aquca_003_00565.2|PACid:22050448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]