SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00566.1|PACid:22050573 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00566.1|PACid:22050573
Domain Number 1 Region: 638-959
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 5.49e-66
Family DNA repair protein MutS, domain III 0.00061
Further Details:      
 
Domain Number 2 Region: 973-1210
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.02e-47
Family ABC transporter ATPase domain-like 0.00000912
Further Details:      
 
Domain Number 3 Region: 304-427
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 5.23e-32
Family DNA repair protein MutS, domain I 0.00091
Further Details:      
 
Domain Number 4 Region: 438-506,559-650
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 0.000000017
Family DNA repair protein MutS, domain II 0.0092
Further Details:      
 
Domain Number 5 Region: 35-76
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000963
Family Tudor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00566.1|PACid:22050573
Sequence length 1270
Sequence
KKPLLVIGGPSQKSPISDNNTMKTPESVKKLYKENVVGKRIRVYWPLDDSWYEGYVKSLD
DLSGKHLIQYDDAEEEVLDLNKEKIEWVEEEVKSFKRLKRNSGSVKSVLEEGDESNEGRK
SRRLNRNLVSEKLVFDDEDDDEEGEREDDSADEDWGKNSTKETVNDEDSEEIDLVDEDSE
EIDLVDEDEEEDKDVGTSKKTRGKKSTESKKRKKDDGVELGSGKKNKSSGKQEKIVHQNV
GGRLIEPVINTERGQSPDVVNNILTVDVAERFNMREAEKFRFLGVERRDAKRRRPGDLNY
DNRTLYLPPDFLKRLSEGQRQWWEFKAKHMDKVLFFKMGKFYELFEMDAHIGAKELDLQY
MKGEQPHCGFPEKNFTMNVEKLAKKGYRILVVEQTETPEQLEIRRKEKGSKDKVVKREVC
AVVTKGTLTEGEIMATNPDASYLMAVTESFWVSESKEENLIIGVCVVDVSTSKFILGQFG
DDSERNSLCALLTELRPVEIIKPAKVLSAESERVLLRHTRNPLVNDLVPDSEFWNASRTV
DEIRDVYKRLKDQPVYEKDCGVLDSNTVEDHARVLPDVLSELVDAGENGSSALSAFGGSL
FYLRQAFLDETLLRFAKFELLPCSGFRDLFQKPYMVLDSAAIENLEIFENNRNGSSSGTL
YAQLNHCVTAFGKRLLKSWLARPLYHPRSIKERQDAVASLRGDAQSSVLDFRKELSRLPD
MERLLSRLFARCEGNGRNANKVILYEDAGKRKLQELISALRGCELLAGAFSSLSVVRNNV
ESTLLGSLLTSGIPDVHSVINDFKEAFDWVEADRTGRIIPHEGVDKEYDSACKILKEVES
CLTSHLKEQRKVLGDASINYVTIGKDLYLLEVPESLQGSIPRDYELRSSKKGFSRYWTPQ
IKKLLGELSLAEAEKESKLKSILQRLIGRFCEHHLKWRQLVSAAAELDALISLSIASDYY
EGNSCQPTILSPPSSSEVPCLSAKGLGHPVLRSDALGKGAFVPNDITVGGARHASFLLLT
GPNMGGKSTLLRQVCMAVILAQLGADVPAEDFNLSPVDRIFVRMGASDNIMAGQSTFLTE
LSETASMLSSATRNSLVVLDELGRGTSTSDGQAIAESVLEHFVHKINCRGLFSTHYHRLA
VDYEKDPQVSLCHMACQVEEGALGVEQVTFLYRLTPGACPKSYGVNVARLAGLPDSILHK
AAAKSREFEETYGKHSQGPIELSTSGWDKKVADILRDLSNVVAKSSCNETRDDGLLTSVH
QRARLLLQGS
Download sequence
Identical sequences A0A2G5EZI7
Aquca_003_00566.1|PACid:22050573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]