SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00576.2|PACid:22049235 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00576.2|PACid:22049235
Domain Number 1 Region: 776-970
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-39
Family Extended AAA-ATPase domain 0.0000119
Further Details:      
 
Domain Number 2 Region: 1105-1244
Classification Level Classification E-value
Superfamily FtsH protease domain-like 7.46e-25
Family FtsH protease domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00576.2|PACid:22049235
Sequence length 1279
Sequence
MVFVMESLISISSSSSSIDRFTSLSHHSKLNLFSTSSSSCSRFSSNSRSIRRKRLNIQKF
SIYCCNKSLNSIEISKFKLLDSLNSSNSVKLDKSLSFRCEEDNVFNCIRNSIVLTVFCIV
VSFFPVKLLQKPAIAIPFVGLLSREKKETKEESKWKEHEFAGYTKRLLETVSVLLKSIED
VRSSKGNMNDVKKALKVVELKKSEFQEEIRSALNAELEVMVKERKALVKRSEEIVDLVST
YQSEHEKLLKNVREGDEVDNGPIERLEEKMNVAEKEYDEIWEKVGEIEDKILRRETLSFS
VGIRELCFIERESQLLVENFNHEIKHRNISSVPTSSTTMHSKSDIQRELEVAQREYWEKM
LLPRVLEVEESGIPLDQNTKNFVVNIKQGFEESRELQRKVEAGIRQKMKRYGNERRFLLK
TPEDEVVKGYPEAELKWVFGNKEVAVPKAIRLHLFHGWKKWQEEAKAELKQNLLQNVDQG
KQYVAQIQERILVDRDRVVAKTWFNEERNRWEMDPLAVPYAVTKKLVENVRIRHDWGAMY
VALKGEDKEYYVDIQELDVLFEDFGGFDGLYLKMLASGIPTAVQLMLIPFSELDIRQQFL
VTTRFTYQWLVRLWKLEKVSEKRELFCEIFQNTSDDIMVMIVFPIMDSIIPYPIRMRLGM
AWPEWADQSVGSTWYLEWQSEAEINFKSRKDDSFLWHLWFFIRAFIYGYVLLNVLCYMKK
KAPRVLGYGRIQRDPNLRKLWRVKAYRKFKKQRKRRRIKAGTDPIPSAFDRMKRIKNPPI
PLKEFASVDSMREEINEVVAFLQNPSAFREMGARAPRGVLIVGERGTGKTSLALAIAAEA
KVPLVEVKSQQLEAGLWVGQSASNVRELFQTARDLAPVIIFVEDFDLFAGVRGKFIHTQN
QDHEAFINQLLVELDGFEKQDGVVLMATTRNVKQIDPALRRPGRMDRVFNLQRPTQMERE
KILQISAKETMDDELIDFVDWSKVAEKTALLRPIELKLVPVALECSAFRSKFLDIDELMS
YSGWFATFSGIVPGLLRRTKVMKGIAKWLVNHLGLTLTKEDLQSVVDLMEPYGQISNGIE
LLNPPLDGIGCTKFTNANEGSANGNIDTRSYLEKKLVFCFGSLVASQMLLPFGEDNFLSS
SEIKKAQEIATRMVIQYGWGPDDSPAIYISSNAVTALSMGNNHEYEIAAKVERMYNLAYD
KAKDMLQQNRQVLEKIVEELLELEMLSGKDLGRILEENGGILEKEPFFLSSFCCKELPSG
GSPDGENASGLALLNATNS
Download sequence
Identical sequences A0A2G5EZG6
Aquca_003_00576.2|PACid:22049235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]