SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00596.1|PACid:22049971 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_003_00596.1|PACid:22049971
Domain Number - Region: 11-56
Classification Level Classification E-value
Superfamily PH domain-like 0.000341
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00596.1|PACid:22049971
Sequence length 67
Sequence
MEVTVERIETEVKKIEDRYELFDVHIGDKRILTLFTDCDSVMKKWVSELRKANREKKKPD
RIGSDIR
Download sequence
Identical sequences A0A2G5EZI2
Aquca_003_00596.1|PACid:22049971 Aquca_096_00036.1|PACid:22039838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]