SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00642.1|PACid:22049220 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00642.1|PACid:22049220
Domain Number 1 Region: 78-192
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000314
Family B3 DNA binding domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00642.1|PACid:22049220
Sequence length 197
Sequence
MKKEEEIHDNSMGVTKLRLFGVEIIGFKLMGVNTFTVKKQVNEIKIETEDINGKMKKMKK
PTLIKDYFSGISIDHQRSFFTIRKKLKKSDVNHLSRLMLSKKMVYNHITPYLTEEQNREV
ESGKGTEILVMDLDMKPCYRLILKRSLKANSYIMKSNWIKSFVQRRKLKEGDEIGMFWDP
SECCFGFSVLQRKTREC
Download sequence
Identical sequences A0A2G5EZQ1
Aquca_003_00642.1|PACid:22049220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]