SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00651.4|PACid:22050359 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00651.4|PACid:22050359
Domain Number 1 Region: 319-504,544-590
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.77e-40
Family Phospholipase D 0.075
Further Details:      
 
Domain Number 2 Region: 241-332
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000135
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Weak hits

Sequence:  Aquca_003_00651.4|PACid:22050359
Domain Number - Region: 742-790
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0889
Family Nuclease 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00651.4|PACid:22050359
Sequence length 804
Sequence
METEELESSGLHRYVQMQSEPLISSSSHSIQPNWIFDELPKAQIVSVSRPDAADFSPMLL
SYVIELHYKQFKWRLHKKASQVIFLHFALKKRAIIEEIHEKQEQVKEWLQSLGIGDHTTV
VQDDDEADDDAVHLHHDESAKNRDVPSRAALPIIRPALGRQQSISDSAKVAMQGYLNHFL
GNLDIANSREVCKFLEVSRLSFASEYGPKLKEDYVMVKHLPKISKDGDDRKCCSCQMFSC
CNDNWQKVWGVLKPGFLALLEDPLDTKLLDIIVFDVLPASDETGEGRVSLAKEMKERNPL
RYAFKISCGNQNVKLRVRTSAKVKDWVSAINDTGLKPPEGWCHPHRFGSFAPLRGLTEDG
SEAQWFVDGQAAFGAMASAFEEAKSEIFITDWWLCPELYLRRPFHVHGSSRLDAILEAKA
KQGVQIYILLYKEVALALKINSVYSKRKLLNIHENVRVLRYPDHFSTMVFQWSHHEKLVI
IDSRICFIGGLDLCFGRYDTFEHKLGDFPPQIWPGKDYYNPRESEPNSWEDTMKDELDRQ
KYPRMPWHDVHCAVWGPPCRDIARHFVQRWNFAKRNKAPNEQAIPLLMPQQHMVIPHYMG
KSIDIENTSKKVEDNHIGLKRQDSFSSRSSVQDIPLLLPQDADGLDAGRDDQNLNGLDTT
NNVVDQSRRVSRSLPFSLRKSKVDPLVSDFQMKDFVDDLDSMDLQRKKSLEIAYAHRHGS
DKEWWETQERGDQVASIDESGQVGPRTTCRCQVIRSVGQWSAGTSQTEESIHSAHCSLIE
KAEYFVYIEVVISYLIIFWKLTLY
Download sequence
Identical sequences A0A2G5EZR9
Aquca_003_00651.4|PACid:22050359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]