SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00721.1|PACid:22050384 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00721.1|PACid:22050384
Domain Number 1 Region: 1072-1255,1289-1341
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.33e-24
Family WD40-repeat 0.0036
Further Details:      
 
Domain Number 2 Region: 551-610,646-662,697-879,923-976
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000269
Family Clathrin adaptor core protein 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00721.1|PACid:22050384
Sequence length 1344
Sequence
MEVFHSKPVYLDSETLDFQFIRVFVVQINQYILKFLEDPETRNSLRQRCTSMLQIQKQEF
FEFSEHSVLSNLYWGIESIEAAIQAKWPEEKISRLKSSERMLQVPALIQEHGSTGGIQNN
YLISCSYFYLSLVRKLQRDDWQVTLHFLHAMLIHPRLVRTEFMPELWENVILPQLMSRKQ
QSGLGESQSESLVDFFDSAFDEPTRQLARRYKDRLIYCQVMLYGENPQWKLGERIAQLEE
SQSFTYSTSTSSESMDSTEHGNGWPKFQDCEKVHPLDIQGSRTGESEKASACIVTRQIGN
TPLQDDGKAFLEKLNEVYNSDAKATSAVKSLQEMLKDSQSDTPVSSCSYNSPDGSPSNME
KRNSLEKRVDKIEGFGSRLSTTEADNSKPEISRRLQTTCSISKPPEATEYLMQKDDYEVY
TSYFFPRRILSSISDLNLPSLETGDIGSDTVSKHVEGTNLRRPEKHDFRLFDHIPSQSIN
NYSFTHKDRHGNSARKSQDIVRRKNLSKTSLHPEKDEHIEMMRIFEHAISTLCFSELIGQ
CEENFVEVSVIWEVLNNKSEARYSLLKDEILDHLLNAISTSHEENIIRASVFILTTIISK
NKAAIEDIKRRGLRLCDLASALKRNVHEAAILIYMVNPSPKEIKALELLPALLDVACTSN
RDVPISIQLTPLAASLMIIEVLVTEFDFTTNSMHLAAISSPPVVTRLANAAADKNTEEII
SLAAILIKCMQYDGKCKQILSQFTSMGPFIRLLRSNEKPAKITGLRFFHEILQMPRSSAI
HLLYQIQEADSLNTAHALMSGIQHLEPEHQVLASNLLLQLDMLVTEDSSGKSIFRDEAME
VLLKAMISEQSSKQVLSASILSNIGGTYAWAGEPYTAAWLVKRIGLTSNRHRNMIRNFDW
SDQSLQDGGIDAWCSKVAQNFIAIGNPVFHALEKGLRSKTRCVSRDCLIAVAWLGCEIAK
KSPSDIRYSACQILLSGIEQFLHPGVDLDERLLACLSVYNYASGEGMQKLMHFSEGVQES
LRRLSSITWIADELLKVTEYFLPAKSRVSCVHTQILEAGYNCGVAASALIYYKGQLYSGH
SDGSIKVWDIEGQTAMLVWDVKEHKNAVTCFTLSEPGDSLVSGSADSTIRVWQMVQRRLE
CVEVIGAKEPVHKLESYKNFIFVITKSRGVKVVFDKSRKVKSICKNKHVKCMAIVQGKLY
VGCRDSSIQEVDIKNEREQEIKAPSKRWWKQNKPVNAILGYKEWLYSASVHVEGSVLKER
SKHEEPQMSISMEKGKHVQAMGVVEDFIYLTCGLSPSIIEIWLRGTQRKVGRLSAGSKIT
CLLTANDMVLCGTETGLIKGWIPL
Download sequence
Identical sequences A0A2G5F034
Aquca_003_00721.1|PACid:22050384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]