SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_003_00813.2|PACid:22050139 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_003_00813.2|PACid:22050139
Domain Number 1 Region: 28-305
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000123
Family WD40-repeat 0.011
Further Details:      
 
Domain Number 2 Region: 854-895
Classification Level Classification E-value
Superfamily RING/U-box 0.0000353
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Weak hits

Sequence:  Aquca_003_00813.2|PACid:22050139
Domain Number - Region: 380-530
Classification Level Classification E-value
Superfamily ARM repeat 0.000196
Family Clathrin heavy-chain linker domain 0.051
Further Details:      
 
Domain Number - Region: 345-392,668-708
Classification Level Classification E-value
Superfamily TPR-like 0.0292
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_003_00813.2|PACid:22050139
Sequence length 958
Sequence
MYQWRKFEFFEEKSAGKSSIPEEVVGKIECCSSGRGRIVLGCDDGTVNLLDRGMKHVYGF
QAHASSVLFLQQLKQRNFLVTIGEDEQTSPQLSPLCLKVFDLDKMQTEGTSTAAPECIQI
LRIFTNQFPEAKITSLLVLEEAPPILLISIGLDNGCVYCIKGDIARERITRFKLQVEDVS
DKNNISVTGLGFRVDGQTLQLFATTPNSVSLFSLHDQPPRRHTLDQIGCGVNSVAMSDRM
ELIIGRTEAVYFYEVDGRGPCWAFEGEKKLIGWFRGYLLCVIADQRNGKNTFNVYDLKNR
LIAHSLVVKEVSHMLCEWGNIILIMSDKTTLSIGEKDMESKLDMLFKKNLYTVAINIVQS
QQADAAATAEVLRKYGDHLYGKQDYDEAMAQYIHTIGHLEPSFVIQKFLDAQRIYNLTNY
LEKLHEKGLASKDHTTLLLNCYTKSKDVEKLDMFIKSEEGAGEHKFDVETAIRVCRAAGY
HEHAMFVAKKAGKHEWYLKILLEDLDRFQEALQYISSLEPSQAGVTMKEYGKILVDHRPS
ETIKILLRLCTEEGESSKGATSNGTYLSMLPSPVDFLNIFVHHPRSLMEFLEKYTSKVKD
SPAQVEIHNTLLELYLSNDLYFPSISQENGGDPLGARTRVPYLSRARSKEKLDAEGDADT
HKIKDRLERHAKGLRLLKSAWPSDLENPVYDVDLAIILCEMNAFKEGLLFLYEKMMLYKD
VISCYMQAHDHEGLIACCKRLGDSTKGGDPSLWGDLLKYFGELGEDCSTEVKEVLTYIEK
DDILPPVIVIQTLSKNPCLTLSVVKDYIARKLDQESKLIEEDRQSIDKYQEETLVMKKEI
QDLRTNARIFQLSKCTACTFTLDLPAVHFMCMHSFHLRCLGDNEKECPECAPEYRAVLDM
KRSLEHNAKDQDRFFQQVKSSKNGFSVIAEYFGKGIVSKTSNGSSDTLRSGTSSMNGF
Download sequence
Identical sequences A0A2G5F0Q3
Aquca_003_00813.1|PACid:22050141 Aquca_003_00813.2|PACid:22050139 Aquca_003_00813.3|PACid:22050140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]